Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | C7M42_RS07910 | Genome accession | NZ_CP028249 |
| Coordinates | 1648668..1649093 (-) | Length | 141 a.a. |
| NCBI ID | WP_128211868.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain SRCM102732 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1619416..1658110 | 1648668..1649093 | within | 0 |
Gene organization within MGE regions
Location: 1619416..1658110
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M42_RS07710 (C7M42_01564) | - | 1619416..1620537 (-) | 1122 | WP_128211675.1 | peptidoglycan recognition family protein | - |
| C7M42_RS07715 (C7M42_01565) | - | 1620521..1620763 (-) | 243 | WP_128211673.1 | phage holin | - |
| C7M42_RS07720 (C7M42_01566) | - | 1620763..1621146 (-) | 384 | WP_229092876.1 | hypothetical protein | - |
| C7M42_RS10540 (C7M42_01567) | - | 1621097..1621243 (-) | 147 | WP_075139822.1 | XkdX family protein | - |
| C7M42_RS07730 (C7M42_01568) | - | 1621243..1621521 (-) | 279 | WP_128211671.1 | hypothetical protein | - |
| C7M42_RS07735 (C7M42_01569) | - | 1621521..1622480 (-) | 960 | WP_128211669.1 | hypothetical protein | - |
| C7M42_RS07740 (C7M42_01570) | - | 1622473..1624206 (-) | 1734 | WP_128211667.1 | BppU family phage baseplate upper protein | - |
| C7M42_RS07745 (C7M42_01571) | - | 1624206..1624517 (-) | 312 | WP_128211665.1 | hypothetical protein | - |
| C7M42_RS07750 (C7M42_01572) | - | 1624518..1624838 (-) | 321 | WP_128211663.1 | hypothetical protein | - |
| C7M42_RS07755 (C7M42_01573) | - | 1624828..1626042 (-) | 1215 | WP_128211660.1 | phage tail protein | - |
| C7M42_RS07760 (C7M42_01574) | - | 1625972..1626805 (-) | 834 | WP_128211658.1 | phage tail domain-containing protein | - |
| C7M42_RS07765 (C7M42_01575) | - | 1626818..1631932 (-) | 5115 | WP_128211656.1 | tape measure protein | - |
| C7M42_RS10245 (C7M42_01576) | - | 1631936..1632106 (-) | 171 | WP_164873654.1 | hypothetical protein | - |
| C7M42_RS07770 (C7M42_01577) | - | 1632139..1632543 (-) | 405 | WP_128211654.1 | phage tail tube assembly chaperone | - |
| C7M42_RS07775 (C7M42_01578) | - | 1632680..1633282 (-) | 603 | WP_159215558.1 | phage tail protein | - |
| C7M42_RS07780 (C7M42_01579) | - | 1633295..1633669 (-) | 375 | WP_159215557.1 | DUF806 family protein | - |
| C7M42_RS07785 (C7M42_01580) | - | 1633672..1634085 (-) | 414 | WP_128211804.1 | HK97 gp10 family phage protein | - |
| C7M42_RS07790 (C7M42_01581) | - | 1634085..1634444 (-) | 360 | WP_128211806.1 | phage head closure protein | - |
| C7M42_RS07795 (C7M42_01582) | - | 1634422..1634745 (-) | 324 | WP_128211808.1 | head-tail connector protein | - |
| C7M42_RS07800 (C7M42_01583) | - | 1634761..1635231 (-) | 471 | WP_128211810.1 | Ig-like domain-containing protein | - |
| C7M42_RS07805 (C7M42_01584) | - | 1635314..1636648 (-) | 1335 | WP_230312668.1 | phage major capsid protein | - |
| C7M42_RS07810 (C7M42_01585) | - | 1636649..1637239 (-) | 591 | WP_128211820.1 | HK97 family phage prohead protease | - |
| C7M42_RS07815 (C7M42_01586) | - | 1637223..1638335 (-) | 1113 | WP_128211812.1 | phage portal protein | - |
| C7M42_RS07820 (C7M42_01587) | - | 1638536..1640410 (-) | 1875 | WP_128211814.1 | terminase TerL endonuclease subunit | - |
| C7M42_RS07825 (C7M42_01588) | - | 1640410..1640874 (-) | 465 | WP_128211816.1 | phage terminase small subunit P27 family | - |
| C7M42_RS07830 (C7M42_01589) | - | 1641073..1641372 (-) | 300 | WP_128212003.1 | hypothetical protein | - |
| C7M42_RS07835 (C7M42_01590) | - | 1641369..1641824 (-) | 456 | WP_128212001.1 | HNH endonuclease | - |
| C7M42_RS07840 (C7M42_01591) | - | 1641909..1642229 (-) | 321 | WP_159215554.1 | bacteriocin immunity protein | - |
| C7M42_RS07845 (C7M42_01592) | - | 1642451..1642885 (-) | 435 | WP_128211997.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| C7M42_RS07850 (C7M42_01594) | - | 1643222..1643485 (-) | 264 | WP_128211995.1 | hypothetical protein | - |
| C7M42_RS07855 (C7M42_01595) | - | 1643499..1643807 (-) | 309 | WP_200834124.1 | hypothetical protein | - |
| C7M42_RS07860 (C7M42_01596) | - | 1643811..1644176 (-) | 366 | WP_159215553.1 | hypothetical protein | - |
| C7M42_RS07865 (C7M42_01597) | - | 1644193..1644393 (-) | 201 | WP_128211852.1 | hypothetical protein | - |
| C7M42_RS07870 (C7M42_01598) | - | 1644393..1644533 (-) | 141 | WP_159215552.1 | hypothetical protein | - |
| C7M42_RS07875 (C7M42_01599) | - | 1644536..1644907 (-) | 372 | WP_128211854.1 | N-acetylmuramoyl-L-alanine amidase | - |
| C7M42_RS10250 (C7M42_01600) | - | 1644894..1645043 (-) | 150 | WP_164873659.1 | hypothetical protein | - |
| C7M42_RS07880 (C7M42_01601) | - | 1645040..1645441 (-) | 402 | WP_128211856.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C7M42_RS07885 (C7M42_01602) | - | 1645422..1646054 (-) | 633 | WP_128211858.1 | RNA polymerase subunit sigma-70 | - |
| C7M42_RS07890 (C7M42_01604) | - | 1646172..1646816 (-) | 645 | WP_229092964.1 | ATP-binding protein | - |
| C7M42_RS07895 (C7M42_01605) | - | 1646968..1647720 (-) | 753 | WP_128211862.1 | conserved phage C-terminal domain-containing protein | - |
| C7M42_RS07900 (C7M42_01606) | - | 1647759..1647989 (-) | 231 | WP_128211864.1 | hypothetical protein | - |
| C7M42_RS07905 (C7M42_01607) | - | 1647973..1648656 (-) | 684 | WP_128211866.1 | putative HNHc nuclease | - |
| C7M42_RS07910 (C7M42_01608) | ssb | 1648668..1649093 (-) | 426 | WP_128211868.1 | single-stranded DNA-binding protein | Machinery gene |
| C7M42_RS07915 (C7M42_01609) | - | 1649086..1649784 (-) | 699 | WP_128211870.1 | ERF family protein | - |
| C7M42_RS07920 (C7M42_01610) | - | 1649785..1650240 (-) | 456 | WP_128211872.1 | chromosome segregation protein SMC | - |
| C7M42_RS07925 (C7M42_01612) | - | 1650464..1651126 (+) | 663 | WP_159215551.1 | hypothetical protein | - |
| C7M42_RS07930 (C7M42_01613) | - | 1651236..1651490 (-) | 255 | WP_128211987.1 | hypothetical protein | - |
| C7M42_RS07935 (C7M42_01614) | - | 1651591..1651920 (-) | 330 | WP_128211985.1 | DUF771 domain-containing protein | - |
| C7M42_RS07940 (C7M42_01616) | - | 1652217..1652999 (-) | 783 | WP_128211989.1 | phage antirepressor | - |
| C7M42_RS07945 (C7M42_01617) | - | 1653105..1653299 (+) | 195 | WP_128211983.1 | hypothetical protein | - |
| C7M42_RS07950 (C7M42_01618) | - | 1653291..1653428 (-) | 138 | WP_159215550.1 | hypothetical protein | - |
| C7M42_RS07955 (C7M42_01619) | - | 1653442..1653660 (-) | 219 | WP_235016628.1 | helix-turn-helix transcriptional regulator | - |
| C7M42_RS07960 (C7M42_01620) | - | 1653719..1654027 (+) | 309 | WP_128211981.1 | hypothetical protein | - |
| C7M42_RS07965 (C7M42_01621) | - | 1654017..1654223 (-) | 207 | WP_159215549.1 | hypothetical protein | - |
| C7M42_RS07970 (C7M42_01622) | - | 1654480..1654821 (+) | 342 | WP_002831842.1 | helix-turn-helix domain-containing protein | - |
| C7M42_RS07975 (C7M42_01623) | - | 1654830..1655237 (+) | 408 | WP_128212081.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C7M42_RS07980 (C7M42_01624) | - | 1655300..1656427 (+) | 1128 | WP_159215548.1 | hypothetical protein | - |
| C7M42_RS07985 (C7M42_01625) | - | 1656574..1656771 (+) | 198 | WP_053905909.1 | hypothetical protein | - |
| C7M42_RS07990 (C7M42_01626) | - | 1656995..1658110 (+) | 1116 | WP_128212073.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15657.41 Da Isoelectric Point: 7.9971
>NTDB_id=283705 C7M42_RS07910 WP_128211868.1 1648668..1649093(-) (ssb) [Pediococcus acidilactici strain SRCM102732]
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=283705 C7M42_RS07910 WP_128211868.1 1648668..1649093(-) (ssb) [Pediococcus acidilactici strain SRCM102732]
ATGATTAATCGAACAGTCCTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
ATGATTAATCGAACAGTCCTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.709 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.037 |
76.596 |
0.475 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.662 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.958 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.958 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.254 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |