Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LL14B4_RS12770 | Genome accession | NZ_CP028160 |
| Coordinates | 2557301..2557726 (-) | Length | 141 a.a. |
| NCBI ID | WP_109991390.1 | Uniprot ID | A0A2Z3KHN3 |
| Organism | Lactococcus lactis subsp. lactis strain 14B4 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2529248..2565535 | 2557301..2557726 | within | 0 |
Gene organization within MGE regions
Location: 2529248..2565535
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL14B4_RS12575 (LL14B4_12565) | - | 2529248..2530246 (+) | 999 | WP_109991354.1 | IS30 family transposase | - |
| LL14B4_RS12580 (LL14B4_12570) | - | 2530427..2530963 (+) | 537 | WP_109991355.1 | hypothetical protein | - |
| LL14B4_RS12585 (LL14B4_12575) | - | 2531062..2531814 (-) | 753 | WP_109991356.1 | Panacea domain-containing protein | - |
| LL14B4_RS12590 (LL14B4_12580) | - | 2531818..2532462 (-) | 645 | WP_109991357.1 | hypothetical protein | - |
| LL14B4_RS12595 (LL14B4_12585) | - | 2532735..2533160 (-) | 426 | WP_109991358.1 | DUF1761 domain-containing protein | - |
| LL14B4_RS12600 (LL14B4_12590) | - | 2533244..2534584 (-) | 1341 | WP_109991359.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LL14B4_RS12605 (LL14B4_12595) | - | 2534581..2534931 (-) | 351 | WP_109991360.1 | holin | - |
| LL14B4_RS12610 (LL14B4_12600) | - | 2534980..2536266 (-) | 1287 | WP_109991361.1 | pyocin knob domain-containing protein | - |
| LL14B4_RS12615 (LL14B4_12605) | - | 2536276..2537394 (-) | 1119 | WP_109991362.1 | siphovirus ReqiPepy6 Gp37-like family protein | - |
| LL14B4_RS12620 (LL14B4_12610) | - | 2537396..2538247 (-) | 852 | WP_109991363.1 | phage distal tail protein | - |
| LL14B4_RS12625 (LL14B4_12615) | - | 2538260..2541739 (-) | 3480 | WP_109991364.1 | phage tail tape measure protein | - |
| LL14B4_RS12630 (LL14B4_12620) | - | 2541739..2542311 (-) | 573 | WP_109991365.1 | Gp15 family bacteriophage protein | - |
| LL14B4_RS12635 (LL14B4_12625) | - | 2542324..2542797 (-) | 474 | WP_109991366.1 | hypothetical protein | - |
| LL14B4_RS12640 (LL14B4_12630) | - | 2542855..2543124 (-) | 270 | WP_338067065.1 | fibronectin type III domain-containing protein | - |
| LL14B4_RS12645 (LL14B4_12635) | - | 2543198..2543680 (-) | 483 | WP_109991368.1 | phage tail tube protein | - |
| LL14B4_RS12650 (LL14B4_12640) | - | 2543673..2544086 (-) | 414 | WP_109991369.1 | minor capsid protein | - |
| LL14B4_RS12655 (LL14B4_12645) | - | 2544076..2544447 (-) | 372 | WP_109991370.1 | minor capsid protein | - |
| LL14B4_RS12660 (LL14B4_12650) | - | 2544447..2544794 (-) | 348 | WP_109991371.1 | putative minor capsid protein | - |
| LL14B4_RS12665 (LL14B4_12655) | - | 2544794..2545198 (-) | 405 | WP_109991372.1 | hypothetical protein | - |
| LL14B4_RS12670 (LL14B4_12660) | - | 2545225..2545473 (-) | 249 | WP_109991373.1 | Ig-like domain-containing protein | - |
| LL14B4_RS12675 (LL14B4_12665) | - | 2545491..2546444 (-) | 954 | WP_109991374.1 | phage major capsid protein | - |
| LL14B4_RS12680 (LL14B4_12670) | - | 2546455..2547033 (-) | 579 | WP_109991375.1 | phage scaffolding protein | - |
| LL14B4_RS12690 (LL14B4_12680) | - | 2547222..2547470 (-) | 249 | WP_031558864.1 | DUF6275 family protein | - |
| LL14B4_RS12695 (LL14B4_12685) | - | 2547520..2548719 (-) | 1200 | WP_239449814.1 | phage minor capsid protein | - |
| LL14B4_RS12700 (LL14B4_12690) | - | 2548722..2550266 (-) | 1545 | WP_109991377.1 | phage portal protein | - |
| LL14B4_RS12705 (LL14B4_12695) | - | 2550268..2551473 (-) | 1206 | WP_162551491.1 | PBSX family phage terminase large subunit | - |
| LL14B4_RS12710 (LL14B4_12700) | - | 2551466..2551861 (-) | 396 | WP_109991379.1 | phBC6A51 family helix-turn-helix protein | - |
| LL14B4_RS12715 (LL14B4_12705) | - | 2552036..2552494 (-) | 459 | WP_109991380.1 | hypothetical protein | - |
| LL14B4_RS12720 (LL14B4_12710) | - | 2552504..2553304 (-) | 801 | WP_109991381.1 | hypothetical protein | - |
| LL14B4_RS12725 (LL14B4_12715) | - | 2553308..2553859 (-) | 552 | WP_109991382.1 | LemA family protein | - |
| LL14B4_RS13610 | - | 2553980..2554333 (-) | 354 | WP_239449824.1 | DUF1642 domain-containing protein | - |
| LL14B4_RS12735 (LL14B4_12725) | - | 2554326..2554601 (-) | 276 | WP_109991383.1 | hypothetical protein | - |
| LL14B4_RS12740 (LL14B4_12730) | - | 2554598..2554804 (-) | 207 | WP_109991384.1 | hypothetical protein | - |
| LL14B4_RS12745 (LL14B4_12735) | - | 2554822..2555010 (-) | 189 | WP_109991385.1 | hypothetical protein | - |
| LL14B4_RS12750 (LL14B4_12740) | - | 2555007..2555432 (-) | 426 | WP_109991386.1 | hypothetical protein | - |
| LL14B4_RS12755 (LL14B4_12745) | - | 2555492..2555863 (+) | 372 | WP_109991387.1 | hypothetical protein | - |
| LL14B4_RS13365 | - | 2555793..2556002 (-) | 210 | WP_162551492.1 | hypothetical protein | - |
| LL14B4_RS12760 (LL14B4_12750) | - | 2556018..2556260 (-) | 243 | WP_109991388.1 | hypothetical protein | - |
| LL14B4_RS12765 (LL14B4_12755) | - | 2556253..2557176 (-) | 924 | WP_109991389.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LL14B4_RS12770 (LL14B4_12760) | ssb | 2557301..2557726 (-) | 426 | WP_109991390.1 | single-stranded DNA-binding protein | Machinery gene |
| LL14B4_RS12775 (LL14B4_12765) | - | 2557719..2558792 (-) | 1074 | WP_109991391.1 | DUF1351 domain-containing protein | - |
| LL14B4_RS12780 (LL14B4_12770) | bet | 2558794..2559531 (-) | 738 | WP_109991392.1 | phage recombination protein Bet | - |
| LL14B4_RS12785 (LL14B4_12775) | - | 2559635..2559871 (-) | 237 | WP_109991393.1 | DUF1408 domain-containing protein | - |
| LL14B4_RS12790 (LL14B4_12780) | - | 2559871..2560068 (-) | 198 | WP_109991394.1 | helix-turn-helix domain-containing protein | - |
| LL14B4_RS12795 (LL14B4_12785) | - | 2560189..2560470 (+) | 282 | WP_109991395.1 | DUF3892 domain-containing protein | - |
| LL14B4_RS12800 (LL14B4_12790) | - | 2560500..2560691 (-) | 192 | WP_109991396.1 | hypothetical protein | - |
| LL14B4_RS12805 (LL14B4_12795) | - | 2560834..2561079 (-) | 246 | WP_109991397.1 | hypothetical protein | - |
| LL14B4_RS12810 (LL14B4_12800) | - | 2561092..2561844 (-) | 753 | WP_109991398.1 | Rha family transcriptional regulator | - |
| LL14B4_RS12815 (LL14B4_12805) | - | 2561863..2562093 (-) | 231 | WP_015966797.1 | helix-turn-helix transcriptional regulator | - |
| LL14B4_RS12820 (LL14B4_12810) | - | 2562274..2563035 (+) | 762 | WP_109991399.1 | hypothetical protein | - |
| LL14B4_RS12825 (LL14B4_12815) | - | 2563267..2564004 (+) | 738 | WP_204162922.1 | XRE family transcriptional regulator | - |
| LL14B4_RS12830 (LL14B4_12820) | - | 2564016..2564339 (+) | 324 | WP_109991401.1 | hypothetical protein | - |
| LL14B4_RS12835 (LL14B4_12825) | - | 2564390..2565535 (+) | 1146 | WP_109991402.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15694.46 Da Isoelectric Point: 8.9291
>NTDB_id=281840 LL14B4_RS12770 WP_109991390.1 2557301..2557726(-) (ssb) [Lactococcus lactis subsp. lactis strain 14B4]
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRQFKNSNGEREADFINCIIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENKQGQRVYITEVVASNFQVLEKSNQANGERVGKPTANQSNSAPFGSSPKEISDDDMPF
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRQFKNSNGEREADFINCIIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENKQGQRVYITEVVASNFQVLEKSNQANGERVGKPTANQSNSAPFGSSPKEISDDDMPF
Nucleotide
Download Length: 426 bp
>NTDB_id=281840 LL14B4_RS12770 WP_109991390.1 2557301..2557726(-) (ssb) [Lactococcus lactis subsp. lactis strain 14B4]
ATGATTAATAATGTCACATTAGTGGGGCGAATCACTAAAGAGCCCGAATTAAGATATACACAACAAAATAAGGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAGAATTCCAATGGAGAAAGAGAAGCTGACTTTATCAATTGTATTATTT
GGGGTAAATCAGCCGAAAATTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGC
AACTATGAGAATAAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTTGAAAAAAGTAA
TCAAGCAAATGGAGAGCGAGTAGGTAAACCAACTGCTAATCAATCAAACTCTGCCCCATTCGGCAGTTCTCCTAAGGAAA
TATCTGATGATGATATGCCATTTTAG
ATGATTAATAATGTCACATTAGTGGGGCGAATCACTAAAGAGCCCGAATTAAGATATACACAACAAAATAAGGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAGAATTCCAATGGAGAAAGAGAAGCTGACTTTATCAATTGTATTATTT
GGGGTAAATCAGCCGAAAATTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGC
AACTATGAGAATAAACAAGGGCAACGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTTGAAAAAAGTAA
TCAAGCAAATGGAGAGCGAGTAGGTAAACCAACTGCTAATCAATCAAACTCTGCCCCATTCGGCAGTTCTCCTAAGGAAA
TATCTGATGATGATATGCCATTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.624 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.674 |
100 |
0.582 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.731 |
73.759 |
0.418 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.926 |
76.596 |
0.39 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
52.427 |
73.05 |
0.383 |