Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RK60_RS00905 | Genome accession | NZ_CP026968 |
| Coordinates | 186597..187025 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain FDAARGOS_1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 178639..222352 | 186597..187025 | within | 0 |
Gene organization within MGE regions
Location: 178639..222352
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK60_RS00810 (RK60_00810) | - | 178639..179844 (-) | 1206 | WP_016170637.1 | tyrosine-type recombinase/integrase | - |
| RK60_RS00815 (RK60_00815) | - | 179970..180584 (+) | 615 | WP_000191459.1 | hypothetical protein | - |
| RK60_RS00820 (RK60_00820) | - | 180581..180727 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| RK60_RS00825 (RK60_00825) | - | 180817..181212 (-) | 396 | WP_001558060.1 | hypothetical protein | - |
| RK60_RS00830 (RK60_00830) | - | 181241..181675 (-) | 435 | WP_016170817.1 | hypothetical protein | - |
| RK60_RS00835 (RK60_00835) | - | 181693..182154 (-) | 462 | WP_000525004.1 | hypothetical protein | - |
| RK60_RS00840 (RK60_00840) | - | 182167..182481 (-) | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | - |
| RK60_RS00845 (RK60_00845) | - | 182633..182869 (+) | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
| RK60_RS00850 (RK60_00850) | - | 182883..183659 (+) | 777 | WP_025176283.1 | Rha family transcriptional regulator | - |
| RK60_RS00855 (RK60_00855) | - | 183688..183831 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| RK60_RS00860 (RK60_00860) | - | 183821..184030 (-) | 210 | WP_000642492.1 | hypothetical protein | - |
| RK60_RS00865 (RK60_00865) | - | 184086..184331 (+) | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| RK60_RS00870 (RK60_00870) | - | 184300..184665 (-) | 366 | WP_016170627.1 | hypothetical protein | - |
| RK60_RS00875 (RK60_00875) | - | 184720..184935 (+) | 216 | WP_001097552.1 | hypothetical protein | - |
| RK60_RS00880 (RK60_00880) | - | 184960..185223 (+) | 264 | WP_001124160.1 | helix-turn-helix domain-containing protein | - |
| RK60_RS00885 (RK60_00885) | - | 185237..185398 (+) | 162 | WP_047211484.1 | DUF1270 family protein | - |
| RK60_RS00890 (RK60_00890) | - | 185490..185750 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| RK60_RS00895 (RK60_00895) | - | 185760..185981 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| RK60_RS00900 (RK60_00900) | - | 185974..186597 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| RK60_RS00905 (RK60_00905) | ssbA | 186597..187025 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| RK60_RS00910 (RK60_00910) | - | 187039..187713 (+) | 675 | WP_031888948.1 | putative HNHc nuclease | - |
| RK60_RS00915 (RK60_00915) | - | 187820..188668 (-) | 849 | WP_000371251.1 | DUF4393 domain-containing protein | - |
| RK60_RS00920 (RK60_00920) | - | 188732..189445 (+) | 714 | WP_000132054.1 | helix-turn-helix domain-containing protein | - |
| RK60_RS00925 (RK60_00925) | - | 189455..190234 (+) | 780 | WP_000803056.1 | ATP-binding protein | - |
| RK60_RS15030 | - | 190228..190389 (+) | 162 | WP_000237153.1 | hypothetical protein | - |
| RK60_RS00930 (RK60_00930) | - | 190402..190623 (+) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| RK60_RS00935 (RK60_00935) | - | 190633..191037 (+) | 405 | Protein_182 | DUF1064 domain-containing protein | - |
| RK60_RS00940 (RK60_00940) | - | 191042..191227 (+) | 186 | WP_001187252.1 | DUF3113 family protein | - |
| RK60_RS00945 (RK60_00945) | - | 191228..191845 (+) | 618 | WP_000907339.1 | SA1788 family PVL leukocidin-associated protein | - |
| RK60_RS00950 (RK60_00950) | - | 191845..192099 (+) | 255 | WP_000022736.1 | DUF3310 domain-containing protein | - |
| RK60_RS00955 (RK60_00955) | - | 192099..192347 (+) | 249 | WP_060474161.1 | SAV1978 family virulence-associated passenger protein | - |
| RK60_RS00960 (RK60_00960) | - | 192361..192567 (+) | 207 | WP_000693987.1 | hypothetical protein | - |
| RK60_RS00965 (RK60_00965) | - | 192570..192974 (+) | 405 | WP_000695756.1 | hypothetical protein | - |
| RK60_RS00970 (RK60_00970) | - | 192971..193165 (+) | 195 | WP_000983953.1 | hypothetical protein | - |
| RK60_RS15095 (RK60_00975) | - | 193204..193533 (+) | 330 | WP_318655701.1 | YopX family protein | - |
| RK60_RS00980 (RK60_00980) | - | 193530..193919 (+) | 390 | WP_016060009.1 | hypothetical protein | - |
| RK60_RS00985 (RK60_00985) | - | 193912..194160 (+) | 249 | WP_001065061.1 | DUF1024 family protein | - |
| RK60_RS00990 (RK60_00990) | - | 194153..194689 (+) | 537 | WP_000185671.1 | dUTPase | - |
| RK60_RS00995 (RK60_00995) | - | 194726..194932 (+) | 207 | WP_000195794.1 | DUF1381 domain-containing protein | - |
| RK60_RS01000 (RK60_01000) | - | 194929..195132 (+) | 204 | WP_000141180.1 | hypothetical protein | - |
| RK60_RS01005 (RK60_01005) | - | 195125..195361 (+) | 237 | WP_000608275.1 | hypothetical protein | - |
| RK60_RS01010 (RK60_01010) | - | 195351..195740 (+) | 390 | WP_171012236.1 | hypothetical protein | - |
| RK60_RS01015 (RK60_01015) | rinB | 195737..195889 (+) | 153 | WP_000595263.1 | transcriptional activator RinB | - |
| RK60_RS01020 (RK60_01020) | - | 195957..196157 (+) | 201 | WP_000265252.1 | DUF1514 family protein | - |
| RK60_RS15105 | - | 197144..197716 (+) | 573 | Protein_200 | helicase-related protein | - |
| RK60_RS01035 (RK60_01035) | - | 197729..198166 (+) | 438 | WP_000513701.1 | transcriptional regulator | - |
| RK60_RS01040 (RK60_01040) | - | 198328..198642 (+) | 315 | WP_000196700.1 | HNH endonuclease | - |
| RK60_RS01045 (RK60_01045) | - | 198768..199073 (+) | 306 | WP_000778930.1 | P27 family phage terminase small subunit | - |
| RK60_RS01050 (RK60_01050) | - | 199063..200754 (+) | 1692 | WP_000153549.1 | terminase large subunit | - |
| RK60_RS01055 (RK60_01055) | - | 200759..201997 (+) | 1239 | WP_001100670.1 | phage portal protein | - |
| RK60_RS01060 (RK60_01060) | - | 201981..202754 (+) | 774 | WP_000061868.1 | head maturation protease, ClpP-related | - |
| RK60_RS01065 (RK60_01065) | - | 202766..203929 (+) | 1164 | WP_001142735.1 | phage major capsid protein | - |
| RK60_RS01070 (RK60_01070) | - | 203998..204276 (+) | 279 | WP_000050975.1 | head-tail connector protein | - |
| RK60_RS01075 (RK60_01075) | - | 204288..204620 (+) | 333 | WP_000395501.1 | hypothetical protein | - |
| RK60_RS01080 (RK60_01080) | - | 204617..205018 (+) | 402 | WP_000110020.1 | hypothetical protein | - |
| RK60_RS01085 (RK60_01085) | - | 205019..205414 (+) | 396 | WP_001023802.1 | DUF3168 domain-containing protein | - |
| RK60_RS01090 (RK60_01090) | - | 205449..206090 (+) | 642 | WP_000807540.1 | major tail protein | - |
| RK60_RS01095 (RK60_01095) | - | 206182..206637 (+) | 456 | WP_000169127.1 | Ig-like domain-containing protein | - |
| RK60_RS01100 (RK60_01100) | gpG | 206695..207045 (+) | 351 | WP_000589167.1 | phage tail assembly chaperone G | - |
| RK60_RS01105 (RK60_01105) | - | 207087..207245 (+) | 159 | WP_000438833.1 | hypothetical protein | - |
| RK60_RS01110 (RK60_01110) | - | 207259..213459 (+) | 6201 | WP_047211487.1 | phage tail tape measure protein | - |
| RK60_RS01115 (RK60_01115) | - | 213459..214283 (+) | 825 | WP_001190533.1 | phage tail family protein | - |
| RK60_RS01120 (RK60_01120) | - | 214292..215875 (+) | 1584 | WP_000384462.1 | prophage endopeptidase tail family protein | - |
| RK60_RS01125 (RK60_01125) | - | 215875..216165 (+) | 291 | WP_000179860.1 | hypothetical protein | - |
| RK60_RS01130 (RK60_01130) | - | 216181..218091 (+) | 1911 | WP_016170708.1 | hypothetical protein | - |
| RK60_RS01135 (RK60_01135) | - | 218091..219557 (+) | 1467 | WP_047211488.1 | BppU family phage baseplate upper protein | - |
| RK60_RS01140 (RK60_01140) | - | 219557..219946 (+) | 390 | WP_001166599.1 | DUF2977 domain-containing protein | - |
| RK60_RS01145 (RK60_01145) | - | 219939..220103 (+) | 165 | WP_000916020.1 | XkdX family protein | - |
| RK60_RS01150 (RK60_01150) | - | 220149..220448 (+) | 300 | WP_000466775.1 | DUF2951 family protein | - |
| RK60_RS01155 (RK60_01155) | - | 220584..220886 (+) | 303 | WP_000339146.1 | phage holin | - |
| RK60_RS01160 (RK60_01160) | - | 220898..222352 (+) | 1455 | WP_047211489.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=274034 RK60_RS00905 WP_000934385.1 186597..187025(+) (ssbA) [Staphylococcus aureus strain FDAARGOS_1]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=274034 RK60_RS00905 WP_000934385.1 186597..187025(+) (ssbA) [Staphylococcus aureus strain FDAARGOS_1]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |