Detailed information NTG0273785

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LL223_RS11650
• Genome accession: NZ_CP031926
• Coordinates: 2261078..2261347 (-)
• Length: 89 a.a.
• NCBI ID: WP_023349160.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain 223
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2256078..2266347

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LL223_RS11610 (LL223_2222)	-	2256614..2257423 (-)	810	WP_010906310.1	metal ABC transporter permease	-
LL223_RS11615 (LL223_2223)	-	2257416..2258153 (-)	738	WP_010906311.1	metal ABC transporter ATP-binding protein	-
LL223_RS11620 (LL223_2224)	-	2258330..2259172 (-)	843	WP_010906312.1	metal ABC transporter substrate-binding protein	-
LL223_RS11625 (LL223_2225)	-	2259169..2259606 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
LL223_RS11630 (LL223_2226)	comGG	2259687..2259971 (-)	285	WP_010906314.1	competence type IV pilus minor pilin ComGG	Machinery gene
LL223_RS11635 (LL223_2227)	comGF	2260010..2260456 (-)	447	WP_031296844.1	competence type IV pilus minor pilin ComGF	Machinery gene
LL223_RS11640 (LL223_2228)	comGE	2260419..2260715 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LL223_RS11645 (LL223_2229)	comGD	2260687..2261085 (-)	399	WP_021214886.1	competence type IV pilus minor pilin ComGD	Machinery gene
LL223_RS11650 (LL223_2230)	comGC	2261078..2261347 (-)	270	WP_023349160.1	competence type IV pilus major pilin ComGC	Machinery gene
LL223_RS11655 (LL223_2231)	-	2261494..2262018 (-)	525	WP_014570795.1	GNAT family N-acetyltransferase	-
LL223_RS11660 (LL223_2232)	-	2262097..2262876 (-)	780	WP_058147788.1	peptidoglycan amidohydrolase family protein	-
LL223_RS11665 (LL223_2233)	-	2262876..2263175 (-)	300	WP_031559226.1	phage holin	-
LL223_RS11670 (LL223_2234)	-	2263188..2263538 (-)	351	WP_023349296.1	hypothetical protein	-
LL223_RS11675 (LL223_2235)	-	2263558..2265612 (-)	2055	WP_373270652.1	collagen-like protein	-
LL223_RS11680 (LL223_2236)	-	2265596..2265769 (-)	174	WP_086383510.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10113.52 Da
• Isoelectric Point: 4.2950

>NTDB_id=273785 LL223_RS11650 WP_023349160.1 2261078..2261347(-) (comGC) [Lactococcus lactis subsp. lactis strain 223]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=273785 LL223_RS11650 WP_023349160.1 2261078..2261347(-) (comGC) [Lactococcus lactis subsp. lactis strain 223]
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTCAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGTCAGAATTGCTCAGTGCAGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	88	84.27	0.742
comGC	Streptococcus gordonii str. Challis substr. CH1	57.647	95.506	0.551
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	55.263	85.393	0.472
comGC	Streptococcus mutans UA140	52.055	82.022	0.427
comGC	Streptococcus mutans UA159	52.055	82.022	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	57.812	71.91	0.416