Detailed information NTG0248250

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: CPG32_RS04235
• Genome accession: NZ_CP023539
• Coordinates: 819993..820307 (+)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain FDAARGOS_377
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 814993..825307

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CPG32_RS04205 (CPG32_04205)	-	815785..815988 (+)	204	WP_002459010.1	YqgQ family protein	-
CPG32_RS04210 (CPG32_04210)	-	815985..816971 (+)	987	WP_002491907.1	ROK family glucokinase	-
CPG32_RS04215 (CPG32_04215)	-	816971..817294 (+)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
CPG32_RS04220 (CPG32_04220)	-	817298..817921 (+)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
CPG32_RS04225 (CPG32_04225)	comGA	817968..818942 (+)	975	WP_002491905.1	competence type IV pilus ATPase ComGA	Machinery gene
CPG32_RS04230 (CPG32_04230)	comGB	818914..819978 (+)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
CPG32_RS04235 (CPG32_04235)	comGC	819993..820307 (+)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
CPG32_RS04240 (CPG32_04240)	comGD	820240..820734 (+)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
CPG32_RS04245 (CPG32_04245)	-	820721..821014 (+)	294	WP_002459018.1	hypothetical protein	-
CPG32_RS04250 (CPG32_04250)	-	821076..821435 (+)	360	WP_002459019.1	competence type IV pilus minor pilin ComGF	-
CPG32_RS04260 (CPG32_04260)	-	821589..822107 (+)	519	WP_002459021.1	shikimate kinase	-
CPG32_RS04265 (CPG32_04265)	gcvT	822277..823368 (+)	1092	WP_037540763.1	glycine cleavage system aminomethyltransferase GcvT	-
CPG32_RS04270 (CPG32_04270)	gcvPA	823385..824734 (+)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=248250 CPG32_RS04235 WP_002459016.1 819993..820307(+) (comGC) [Staphylococcus lugdunensis strain FDAARGOS_377]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=248250 CPG32_RS04235 WP_002459016.1 819993..820307(+) (comGC) [Staphylococcus lugdunensis strain FDAARGOS_377]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375