Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | CO686_RS09125 | Genome accession | NZ_CP023507 |
| Coordinates | 1862604..1862729 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799678.1 | Uniprot ID | - |
| Organism | Streptococcus oralis strain FDAARGOS_367 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1857604..1867729
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CO686_RS09100 (CO686_09100) | - | 1859732..1860274 (+) | 543 | WP_000665077.1 | TetR-like C-terminal domain-containing protein | - |
| CO686_RS09115 (CO686_09115) | comE | 1860515..1861267 (-) | 753 | WP_000866082.1 | competence system response regulator transcription factor ComE | Regulator |
| CO686_RS09120 (CO686_09120) | comD | 1861264..1862583 (-) | 1320 | WP_049550146.1 | competence system sensor histidine kinase ComD | Regulator |
| CO686_RS09125 (CO686_09125) | comC/comC2 | 1862604..1862729 (-) | 126 | WP_000799678.1 | competence-stimulating peptide ComC | Regulator |
| CO686_RS09135 (CO686_09135) | rlmH | 1863011..1863490 (-) | 480 | WP_000694219.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| CO686_RS09140 (CO686_09140) | htrA | 1863676..1864872 (+) | 1197 | WP_000681804.1 | S1C family serine protease | Regulator |
| CO686_RS09145 (CO686_09145) | spo0J | 1864930..1865688 (+) | 759 | WP_002881154.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| CO686_RS09150 (CO686_09150) | dnaA | 1865906..1867267 (+) | 1362 | WP_000660630.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4960.73 Da Isoelectric Point: 10.3052
>NTDB_id=247891 CO686_RS09125 WP_000799678.1 1862604..1862729(-) (comC/comC2) [Streptococcus oralis strain FDAARGOS_367]
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=247891 CO686_RS09125 WP_000799678.1 1862604..1862729(-) (comC/comC2) [Streptococcus oralis strain FDAARGOS_367]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
56.098 |
100 |
0.561 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |