Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CGQ03_RS10300 | Genome accession | NZ_CP022905 |
| Coordinates | 1974726..1975151 (-) | Length | 141 a.a. |
| NCBI ID | WP_000934384.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 628 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1939824..1987960 | 1974726..1975151 | within | 0 |
Gene organization within MGE regions
Location: 1939824..1987960
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGQ03_RS10040 (CGQ03_01804) | - | 1939824..1941269 (-) | 1446 | WP_001148135.1 | SH3 domain-containing protein | - |
| CGQ03_RS10045 (CGQ03_01805) | - | 1941250..1941687 (-) | 438 | WP_000354128.1 | phage holin | - |
| CGQ03_RS10050 (CGQ03_01806) | - | 1941743..1942138 (-) | 396 | WP_000398878.1 | hypothetical protein | - |
| CGQ03_RS10055 (CGQ03_01807) | - | 1942144..1943316 (-) | 1173 | WP_033860047.1 | BppU family phage baseplate upper protein | - |
| CGQ03_RS10060 (CGQ03_01808) | - | 1943329..1945203 (-) | 1875 | WP_000524043.1 | glucosaminidase domain-containing protein | - |
| CGQ03_RS10065 (CGQ03_01809) | - | 1945340..1945639 (-) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| CGQ03_RS10070 (CGQ03_01810) | - | 1945680..1945853 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| CGQ03_RS10075 (CGQ03_01811) | - | 1945857..1946234 (-) | 378 | WP_000705893.1 | DUF2977 domain-containing protein | - |
| CGQ03_RS10080 (CGQ03_01812) | - | 1946234..1948057 (-) | 1824 | WP_023487056.1 | BppU family phage baseplate upper protein | - |
| CGQ03_RS10085 (CGQ03_01813) | - | 1948057..1949955 (-) | 1899 | WP_000323256.1 | hypothetical protein | - |
| CGQ03_RS10090 (CGQ03_01814) | - | 1949968..1951854 (-) | 1887 | WP_001604154.1 | SGNH/GDSL hydrolase family protein | - |
| CGQ03_RS10095 (CGQ03_01815) | - | 1951865..1952806 (-) | 942 | WP_001604155.1 | phage tail domain-containing protein | - |
| CGQ03_RS10100 (CGQ03_01816) | - | 1952821..1955706 (-) | 2886 | WP_031870344.1 | terminase | - |
| CGQ03_RS10105 (CGQ03_01817) | - | 1955710..1955994 (-) | 285 | WP_000880587.1 | hypothetical protein | - |
| CGQ03_RS10110 (CGQ03_01818) | - | 1956039..1956545 (-) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| CGQ03_RS10115 (CGQ03_01819) | - | 1956612..1957169 (-) | 558 | WP_000057582.1 | tail protein | - |
| CGQ03_RS10120 (CGQ03_01820) | - | 1957170..1957595 (-) | 426 | WP_000270190.1 | DUF3168 domain-containing protein | - |
| CGQ03_RS10125 | - | 1957608..1957766 (-) | 159 | Protein_1873 | HK97 gp10 family phage protein | - |
| CGQ03_RS10130 (CGQ03_01821) | - | 1957958..1958641 (-) | 684 | WP_044593021.1 | hypothetical protein | - |
| CGQ03_RS10135 (CGQ03_01822) | - | 1958770..1959024 (-) | 255 | Protein_1875 | HK97 gp10 family phage protein | - |
| CGQ03_RS10140 (CGQ03_01823) | - | 1959011..1959346 (-) | 336 | WP_031870341.1 | phage head closure protein | - |
| CGQ03_RS10145 (CGQ03_01824) | - | 1959339..1959653 (-) | 315 | WP_015978368.1 | phage head-tail connector protein | - |
| CGQ03_RS10150 (CGQ03_01825) | - | 1959653..1959979 (-) | 327 | WP_031870340.1 | Rho termination factor N-terminal domain-containing protein | - |
| CGQ03_RS10155 (CGQ03_01826) | - | 1959996..1960955 (-) | 960 | WP_001044072.1 | hypothetical protein | - |
| CGQ03_RS10160 (CGQ03_01827) | - | 1960967..1961491 (-) | 525 | WP_000366930.1 | phage scaffolding protein | - |
| CGQ03_RS10165 (CGQ03_01828) | - | 1961589..1962569 (-) | 981 | WP_015978359.1 | phage head morphogenesis protein | - |
| CGQ03_RS10170 (CGQ03_01829) | - | 1962508..1963986 (-) | 1479 | WP_049955470.1 | phage portal protein | - |
| CGQ03_RS10175 (CGQ03_01830) | - | 1963940..1965148 (-) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| CGQ03_RS15390 (CGQ03_01831) | - | 1965141..1965635 (-) | 495 | WP_031870337.1 | terminase small subunit | - |
| CGQ03_RS10185 (CGQ03_01832) | - | 1965964..1966386 (-) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| CGQ03_RS10190 (CGQ03_01833) | - | 1966410..1966556 (-) | 147 | WP_000989960.1 | hypothetical protein | - |
| CGQ03_RS10195 (CGQ03_01834) | - | 1966557..1966730 (-) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| CGQ03_RS10200 (CGQ03_01835) | - | 1966723..1966959 (-) | 237 | WP_031870336.1 | hypothetical protein | - |
| CGQ03_RS10205 (CGQ03_01836) | - | 1966984..1967220 (-) | 237 | WP_031870335.1 | DUF1381 domain-containing protein | - |
| CGQ03_RS10210 (CGQ03_01837) | - | 1967257..1967799 (-) | 543 | WP_000185654.1 | dUTP pyrophosphatase | - |
| CGQ03_RS10215 (CGQ03_01838) | - | 1967804..1968040 (-) | 237 | WP_001065023.1 | DUF1024 family protein | - |
| CGQ03_RS10220 (CGQ03_01839) | - | 1968033..1968341 (-) | 309 | WP_000144710.1 | hypothetical protein | - |
| CGQ03_RS10225 (CGQ03_01840) | - | 1968338..1968685 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| CGQ03_RS10230 (CGQ03_01841) | - | 1968682..1969083 (-) | 402 | WP_000695762.1 | hypothetical protein | - |
| CGQ03_RS10235 (CGQ03_01842) | - | 1969096..1969344 (-) | 249 | WP_012068339.1 | SAV1978 family virulence-associated passenger protein | - |
| CGQ03_RS10240 (CGQ03_01843) | - | 1969344..1969598 (-) | 255 | WP_000022735.1 | DUF3310 domain-containing protein | - |
| CGQ03_RS10250 (CGQ03_01844) | - | 1969684..1969869 (-) | 186 | WP_001187230.1 | DUF3113 family protein | - |
| CGQ03_RS10255 (CGQ03_01845) | - | 1969874..1970278 (-) | 405 | WP_031895320.1 | DUF1064 domain-containing protein | - |
| CGQ03_RS10260 (CGQ03_01846) | - | 1970275..1970700 (-) | 426 | WP_000451861.1 | phage N-6-adenine-methyltransferase | - |
| CGQ03_RS10265 (CGQ03_01847) | - | 1970710..1970931 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| CGQ03_RS10270 (CGQ03_01848) | - | 1970935..1971150 (-) | 216 | WP_001024405.1 | hypothetical protein | - |
| CGQ03_RS10275 (CGQ03_01849) | - | 1971147..1972388 (-) | 1242 | WP_015445891.1 | DnaB helicase C-terminal domain-containing protein | - |
| CGQ03_RS10280 (CGQ03_01850) | - | 1972385..1972741 (-) | 357 | WP_001132243.1 | hypothetical protein | - |
| CGQ03_RS10285 (CGQ03_01851) | - | 1972741..1973496 (-) | 756 | WP_001037657.1 | DnaD domain protein | - |
| CGQ03_RS10290 (CGQ03_01852) | - | 1973489..1974163 (-) | 675 | WP_015445893.1 | putative HNHc nuclease | - |
| CGQ03_RS10295 (CGQ03_01853) | - | 1974164..1974715 (-) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| CGQ03_RS10300 (CGQ03_01854) | ssbA | 1974726..1975151 (-) | 426 | WP_000934384.1 | single-stranded DNA-binding protein | Machinery gene |
| CGQ03_RS10305 (CGQ03_01855) | - | 1975151..1975774 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| CGQ03_RS10310 (CGQ03_01856) | - | 1975767..1975988 (-) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| CGQ03_RS10315 (CGQ03_01857) | - | 1975998..1976258 (-) | 261 | WP_000291076.1 | DUF1108 family protein | - |
| CGQ03_RS10320 (CGQ03_01858) | - | 1976352..1976513 (-) | 162 | WP_000066026.1 | DUF1270 family protein | - |
| CGQ03_RS15395 (CGQ03_01859) | - | 1976506..1976643 (-) | 138 | WP_000230552.1 | hypothetical protein | - |
| CGQ03_RS10325 (CGQ03_01860) | - | 1976693..1976923 (+) | 231 | WP_000395455.1 | hypothetical protein | - |
| CGQ03_RS10330 (CGQ03_01862) | - | 1977090..1977842 (-) | 753 | WP_023487064.1 | phage antirepressor KilAC domain-containing protein | - |
| CGQ03_RS10335 (CGQ03_01863) | - | 1977844..1978029 (-) | 186 | WP_000933363.1 | helix-turn-helix transcriptional regulator | - |
| CGQ03_RS10340 (CGQ03_01864) | - | 1978469..1978678 (+) | 210 | WP_000642492.1 | hypothetical protein | - |
| CGQ03_RS10345 (CGQ03_01865) | - | 1978668..1978811 (-) | 144 | WP_000939498.1 | hypothetical protein | - |
| CGQ03_RS10350 (CGQ03_01866) | - | 1978826..1979269 (-) | 444 | WP_023487065.1 | hypothetical protein | - |
| CGQ03_RS10355 (CGQ03_01867) | - | 1979282..1979530 (-) | 249 | WP_000272859.1 | helix-turn-helix transcriptional regulator | - |
| CGQ03_RS10360 (CGQ03_01868) | - | 1979694..1980017 (+) | 324 | WP_001260487.1 | helix-turn-helix transcriptional regulator | - |
| CGQ03_RS10365 (CGQ03_01869) | - | 1980030..1980494 (+) | 465 | WP_000525007.1 | hypothetical protein | - |
| CGQ03_RS10370 (CGQ03_01870) | - | 1980526..1981206 (+) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CGQ03_RS10375 (CGQ03_01871) | - | 1981413..1982798 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
| CGQ03_RS10380 (CGQ03_01872) | rpmF | 1982915..1983088 (-) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| CGQ03_RS10390 (CGQ03_01873) | - | 1983168..1983725 (-) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| CGQ03_RS10395 (CGQ03_01874) | - | 1983852..1984991 (+) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| CGQ03_RS10400 (CGQ03_01875) | coaD | 1985053..1985535 (-) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| CGQ03_RS10405 (CGQ03_01876) | rsmD | 1985537..1986079 (-) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| CGQ03_RS10410 (CGQ03_01877) | - | 1986149..1986538 (+) | 390 | WP_000814565.1 | hypothetical protein | - |
| CGQ03_RS10415 (CGQ03_01878) | - | 1986541..1986795 (-) | 255 | WP_001049150.1 | YlbG family protein | - |
| CGQ03_RS10420 (CGQ03_01879) | - | 1987034..1987960 (+) | 927 | WP_000757575.1 | glycerophosphodiester phosphodiesterase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15784.48 Da Isoelectric Point: 8.4826
>NTDB_id=243253 CGQ03_RS10300 WP_000934384.1 1974726..1975151(-) (ssbA) [Staphylococcus aureus strain 628]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=243253 CGQ03_RS10300 WP_000934384.1 1974726..1975151(-) (ssbA) [Staphylococcus aureus strain 628]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
73.729 |
83.688 |
0.617 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.844 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
46.087 |
81.56 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.068 |
83.688 |
0.369 |