Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | CGQ02_RS07160 | Genome accession | NZ_CP022904 |
| Coordinates | 1391736..1392047 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 629 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1386736..1397047
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGQ02_RS07125 (CGQ02_01292) | gcvPA | 1387238..1388584 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| CGQ02_RS07130 (CGQ02_01293) | gcvT | 1388604..1389695 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CGQ02_RS07135 (CGQ02_01294) | - | 1389854..1390378 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| CGQ02_RS07140 | - | 1390368..1390514 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| CGQ02_RS07145 (CGQ02_01295) | comGF | 1390611..1391108 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| CGQ02_RS07150 (CGQ02_01296) | comGE | 1391026..1391325 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| CGQ02_RS07155 (CGQ02_01297) | comGD | 1391312..1391758 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| CGQ02_RS07160 (CGQ02_01298) | comGC | 1391736..1392047 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| CGQ02_RS07165 (CGQ02_01299) | comGB | 1392061..1393131 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| CGQ02_RS07170 (CGQ02_01300) | comGA | 1393103..1394077 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| CGQ02_RS07175 (CGQ02_01301) | - | 1394129..1394752 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| CGQ02_RS07180 (CGQ02_01302) | - | 1394749..1395078 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| CGQ02_RS07185 (CGQ02_01303) | - | 1395078..1396064 (-) | 987 | WP_000161309.1 | ROK family glucokinase | - |
| CGQ02_RS07190 | - | 1396061..1396264 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=243194 CGQ02_RS07160 WP_000472256.1 1391736..1392047(-) (comGC) [Staphylococcus aureus strain 629]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=243194 CGQ02_RS07160 WP_000472256.1 1391736..1392047(-) (comGC) [Staphylococcus aureus strain 629]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |