Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CGQ01_RS04595 | Genome accession | NZ_CP022903 |
| Coordinates | 875985..876410 (+) | Length | 141 a.a. |
| NCBI ID | WP_000934384.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 187 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 868338..911312 | 875985..876410 | within | 0 |
Gene organization within MGE regions
Location: 868338..911312
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGQ01_RS04520 (CGQ01_00810) | - | 868338..869723 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| CGQ01_RS04525 (CGQ01_00811) | - | 869930..870610 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CGQ01_RS04530 (CGQ01_00812) | - | 870642..871106 (-) | 465 | WP_000525007.1 | hypothetical protein | - |
| CGQ01_RS04535 (CGQ01_00813) | - | 871119..871442 (-) | 324 | WP_001260487.1 | helix-turn-helix transcriptional regulator | - |
| CGQ01_RS04540 (CGQ01_00814) | - | 871606..871854 (+) | 249 | WP_000272859.1 | helix-turn-helix transcriptional regulator | - |
| CGQ01_RS04545 (CGQ01_00815) | - | 871867..872310 (+) | 444 | WP_023487065.1 | hypothetical protein | - |
| CGQ01_RS04550 (CGQ01_00816) | - | 872325..872468 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| CGQ01_RS04555 (CGQ01_00817) | - | 872458..872667 (-) | 210 | WP_000642492.1 | hypothetical protein | - |
| CGQ01_RS04560 (CGQ01_00818) | - | 873107..873292 (+) | 186 | WP_000933363.1 | helix-turn-helix transcriptional regulator | - |
| CGQ01_RS04565 (CGQ01_00819) | - | 873294..874046 (+) | 753 | WP_023487064.1 | phage antirepressor KilAC domain-containing protein | - |
| CGQ01_RS04570 (CGQ01_00821) | - | 874213..874443 (-) | 231 | WP_000395455.1 | hypothetical protein | - |
| CGQ01_RS15570 (CGQ01_00822) | - | 874502..874630 (+) | 129 | WP_001559112.1 | hypothetical protein | - |
| CGQ01_RS04575 (CGQ01_00823) | - | 874623..874784 (+) | 162 | WP_000066026.1 | DUF1270 family protein | - |
| CGQ01_RS04580 (CGQ01_00824) | - | 874878..875138 (+) | 261 | WP_000291076.1 | DUF1108 family protein | - |
| CGQ01_RS04585 (CGQ01_00825) | - | 875148..875369 (+) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| CGQ01_RS04590 (CGQ01_00826) | - | 875362..875985 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| CGQ01_RS04595 (CGQ01_00827) | ssbA | 875985..876410 (+) | 426 | WP_000934384.1 | single-stranded DNA-binding protein | Machinery gene |
| CGQ01_RS04600 (CGQ01_00828) | - | 876421..876972 (+) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| CGQ01_RS04605 (CGQ01_00829) | - | 876973..877647 (+) | 675 | WP_015445893.1 | putative HNHc nuclease | - |
| CGQ01_RS04610 (CGQ01_00830) | - | 877640..878395 (+) | 756 | WP_001037657.1 | DnaD domain protein | - |
| CGQ01_RS04615 (CGQ01_00831) | - | 878395..878751 (+) | 357 | WP_001132243.1 | hypothetical protein | - |
| CGQ01_RS04620 (CGQ01_00832) | - | 878748..879989 (+) | 1242 | WP_015445891.1 | DnaB helicase C-terminal domain-containing protein | - |
| CGQ01_RS04625 (CGQ01_00833) | - | 879986..880201 (+) | 216 | WP_001024405.1 | hypothetical protein | - |
| CGQ01_RS04630 (CGQ01_00834) | - | 880205..880426 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| CGQ01_RS04635 (CGQ01_00835) | - | 880436..880861 (+) | 426 | WP_000451861.1 | phage N-6-adenine-methyltransferase | - |
| CGQ01_RS04640 (CGQ01_00836) | - | 880858..881262 (+) | 405 | WP_031895320.1 | DUF1064 domain-containing protein | - |
| CGQ01_RS04645 (CGQ01_00837) | - | 881267..881452 (+) | 186 | WP_001187230.1 | DUF3113 family protein | - |
| CGQ01_RS04655 (CGQ01_00838) | - | 881538..881792 (+) | 255 | WP_000022735.1 | DUF3310 domain-containing protein | - |
| CGQ01_RS04660 (CGQ01_00839) | - | 881792..882040 (+) | 249 | WP_012068339.1 | SAV1978 family virulence-associated passenger protein | - |
| CGQ01_RS04665 (CGQ01_00840) | - | 882053..882454 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| CGQ01_RS04670 (CGQ01_00841) | - | 882451..882798 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| CGQ01_RS04675 (CGQ01_00842) | - | 882795..883103 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| CGQ01_RS04680 (CGQ01_00843) | - | 883096..883332 (+) | 237 | WP_001065023.1 | DUF1024 family protein | - |
| CGQ01_RS04685 (CGQ01_00844) | - | 883337..883879 (+) | 543 | WP_000185654.1 | dUTP pyrophosphatase | - |
| CGQ01_RS04690 (CGQ01_00845) | - | 883916..884152 (+) | 237 | WP_031870335.1 | DUF1381 domain-containing protein | - |
| CGQ01_RS04695 (CGQ01_00846) | - | 884177..884413 (+) | 237 | WP_031870336.1 | hypothetical protein | - |
| CGQ01_RS04700 (CGQ01_00847) | - | 884406..884579 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| CGQ01_RS04705 (CGQ01_00848) | - | 884580..884726 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| CGQ01_RS04710 (CGQ01_00849) | - | 884750..885172 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| CGQ01_RS15350 (CGQ01_00850) | - | 885501..885995 (+) | 495 | WP_031870337.1 | terminase small subunit | - |
| CGQ01_RS04720 (CGQ01_00851) | - | 885988..887196 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| CGQ01_RS04725 (CGQ01_00852) | - | 887210..888628 (+) | 1419 | WP_031870338.1 | phage portal protein | - |
| CGQ01_RS04730 (CGQ01_00853) | - | 888567..889547 (+) | 981 | WP_015978359.1 | phage head morphogenesis protein | - |
| CGQ01_RS04735 (CGQ01_00854) | - | 889645..890169 (+) | 525 | WP_000366930.1 | phage scaffolding protein | - |
| CGQ01_RS04740 (CGQ01_00855) | - | 890181..891140 (+) | 960 | WP_001044072.1 | hypothetical protein | - |
| CGQ01_RS04745 (CGQ01_00856) | - | 891157..891483 (+) | 327 | WP_031870340.1 | Rho termination factor N-terminal domain-containing protein | - |
| CGQ01_RS04750 (CGQ01_00857) | - | 891483..891797 (+) | 315 | WP_015978368.1 | phage head-tail connector protein | - |
| CGQ01_RS04755 (CGQ01_00858) | - | 891790..892125 (+) | 336 | WP_031870341.1 | phage head closure protein | - |
| CGQ01_RS04760 (CGQ01_00859) | - | 892112..892366 (+) | 255 | Protein_887 | HK97 gp10 family phage protein | - |
| CGQ01_RS04765 (CGQ01_00860) | - | 892495..893178 (+) | 684 | WP_044593021.1 | hypothetical protein | - |
| CGQ01_RS04770 | - | 893370..893528 (+) | 159 | Protein_889 | HK97 gp10 family phage protein | - |
| CGQ01_RS04775 (CGQ01_00861) | - | 893541..893966 (+) | 426 | WP_000270190.1 | DUF3168 domain-containing protein | - |
| CGQ01_RS04780 (CGQ01_00862) | - | 893967..894524 (+) | 558 | WP_000057582.1 | tail protein | - |
| CGQ01_RS04785 (CGQ01_00863) | - | 894591..895097 (+) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| CGQ01_RS04790 (CGQ01_00864) | - | 895142..895426 (+) | 285 | WP_000880587.1 | hypothetical protein | - |
| CGQ01_RS04795 (CGQ01_00865) | - | 895430..898315 (+) | 2886 | WP_031870344.1 | terminase | - |
| CGQ01_RS04800 (CGQ01_00866) | - | 898330..899271 (+) | 942 | WP_001604155.1 | phage tail domain-containing protein | - |
| CGQ01_RS04805 (CGQ01_00867) | - | 899282..901168 (+) | 1887 | WP_001604154.1 | SGNH/GDSL hydrolase family protein | - |
| CGQ01_RS04810 (CGQ01_00868) | - | 901181..903079 (+) | 1899 | WP_000323256.1 | hypothetical protein | - |
| CGQ01_RS04815 (CGQ01_00869) | - | 903079..904902 (+) | 1824 | WP_023487056.1 | BppU family phage baseplate upper protein | - |
| CGQ01_RS04820 (CGQ01_00870) | - | 904902..905279 (+) | 378 | WP_000705893.1 | DUF2977 domain-containing protein | - |
| CGQ01_RS04825 (CGQ01_00871) | - | 905283..905456 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| CGQ01_RS04830 (CGQ01_00872) | - | 905497..905796 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| CGQ01_RS04835 (CGQ01_00873) | - | 905933..907807 (+) | 1875 | WP_000524043.1 | glucosaminidase domain-containing protein | - |
| CGQ01_RS04840 (CGQ01_00874) | - | 907820..908992 (+) | 1173 | WP_033860047.1 | BppU family phage baseplate upper protein | - |
| CGQ01_RS04845 (CGQ01_00875) | - | 908998..909393 (+) | 396 | WP_000398878.1 | hypothetical protein | - |
| CGQ01_RS04850 (CGQ01_00876) | - | 909449..909886 (+) | 438 | WP_000354128.1 | phage holin | - |
| CGQ01_RS04855 (CGQ01_00877) | - | 909867..911312 (+) | 1446 | WP_001148135.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15784.48 Da Isoelectric Point: 8.4826
>NTDB_id=243141 CGQ01_RS04595 WP_000934384.1 875985..876410(+) (ssbA) [Staphylococcus aureus strain 187]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=243141 CGQ01_RS04595 WP_000934384.1 875985..876410(+) (ssbA) [Staphylococcus aureus strain 187]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
73.729 |
83.688 |
0.617 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.844 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
46.087 |
81.56 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.068 |
83.688 |
0.369 |