Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CGP90_RS10300 | Genome accession | NZ_CP022894 |
| Coordinates | 1974698..1975123 (-) | Length | 141 a.a. |
| NCBI ID | WP_000934384.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 191 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1939796..1987932 | 1974698..1975123 | within | 0 |
Gene organization within MGE regions
Location: 1939796..1987932
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGP90_RS10040 (CGP90_01804) | - | 1939796..1941241 (-) | 1446 | WP_001148135.1 | SH3 domain-containing protein | - |
| CGP90_RS10045 (CGP90_01805) | - | 1941222..1941659 (-) | 438 | WP_000354128.1 | phage holin | - |
| CGP90_RS10050 (CGP90_01806) | - | 1941715..1942110 (-) | 396 | WP_000398878.1 | hypothetical protein | - |
| CGP90_RS10055 (CGP90_01807) | - | 1942116..1943288 (-) | 1173 | WP_033860047.1 | BppU family phage baseplate upper protein | - |
| CGP90_RS10060 (CGP90_01808) | - | 1943301..1945175 (-) | 1875 | WP_000524043.1 | glucosaminidase domain-containing protein | - |
| CGP90_RS10065 (CGP90_01809) | - | 1945312..1945611 (-) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| CGP90_RS10070 (CGP90_01810) | - | 1945652..1945825 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| CGP90_RS10075 (CGP90_01811) | - | 1945829..1946206 (-) | 378 | WP_000705893.1 | DUF2977 domain-containing protein | - |
| CGP90_RS10080 (CGP90_01812) | - | 1946206..1948029 (-) | 1824 | WP_023487056.1 | BppU family phage baseplate upper protein | - |
| CGP90_RS10085 (CGP90_01813) | - | 1948029..1949927 (-) | 1899 | WP_000323256.1 | hypothetical protein | - |
| CGP90_RS10090 (CGP90_01814) | - | 1949940..1951826 (-) | 1887 | WP_001604154.1 | SGNH/GDSL hydrolase family protein | - |
| CGP90_RS10095 (CGP90_01815) | - | 1951837..1952778 (-) | 942 | WP_001604155.1 | phage tail domain-containing protein | - |
| CGP90_RS10100 (CGP90_01816) | - | 1952793..1955678 (-) | 2886 | WP_031870344.1 | terminase | - |
| CGP90_RS10105 (CGP90_01817) | - | 1955682..1955966 (-) | 285 | WP_000880587.1 | hypothetical protein | - |
| CGP90_RS10110 (CGP90_01818) | - | 1956011..1956517 (-) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| CGP90_RS10115 (CGP90_01819) | - | 1956584..1957141 (-) | 558 | WP_000057582.1 | tail protein | - |
| CGP90_RS10120 (CGP90_01820) | - | 1957142..1957567 (-) | 426 | WP_000270190.1 | DUF3168 domain-containing protein | - |
| CGP90_RS10125 | - | 1957580..1957738 (-) | 159 | Protein_1872 | HK97 gp10 family phage protein | - |
| CGP90_RS10130 (CGP90_01821) | - | 1957930..1958613 (-) | 684 | WP_044593021.1 | hypothetical protein | - |
| CGP90_RS10135 (CGP90_01822) | - | 1958742..1958996 (-) | 255 | Protein_1874 | HK97 gp10 family phage protein | - |
| CGP90_RS10140 (CGP90_01823) | - | 1958983..1959318 (-) | 336 | WP_031870341.1 | phage head closure protein | - |
| CGP90_RS10145 (CGP90_01824) | - | 1959311..1959625 (-) | 315 | WP_015978368.1 | phage head-tail connector protein | - |
| CGP90_RS10150 (CGP90_01825) | - | 1959625..1959951 (-) | 327 | WP_031870340.1 | Rho termination factor N-terminal domain-containing protein | - |
| CGP90_RS10155 (CGP90_01826) | - | 1959968..1960927 (-) | 960 | WP_001044072.1 | hypothetical protein | - |
| CGP90_RS10160 (CGP90_01827) | - | 1960939..1961463 (-) | 525 | WP_000366930.1 | phage scaffolding protein | - |
| CGP90_RS10165 (CGP90_01828) | - | 1961561..1962541 (-) | 981 | WP_015978359.1 | phage head morphogenesis protein | - |
| CGP90_RS10170 (CGP90_01829) | - | 1962480..1963898 (-) | 1419 | WP_031870338.1 | phage portal protein | - |
| CGP90_RS10175 (CGP90_01830) | - | 1963912..1965120 (-) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| CGP90_RS15385 (CGP90_01831) | - | 1965113..1965607 (-) | 495 | WP_031870337.1 | terminase small subunit | - |
| CGP90_RS10185 (CGP90_01832) | - | 1965936..1966358 (-) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| CGP90_RS10190 (CGP90_01833) | - | 1966382..1966528 (-) | 147 | WP_000989960.1 | hypothetical protein | - |
| CGP90_RS10195 (CGP90_01834) | - | 1966529..1966702 (-) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| CGP90_RS10200 (CGP90_01835) | - | 1966695..1966931 (-) | 237 | WP_031870336.1 | hypothetical protein | - |
| CGP90_RS10205 (CGP90_01836) | - | 1966956..1967192 (-) | 237 | WP_031870335.1 | DUF1381 domain-containing protein | - |
| CGP90_RS10210 (CGP90_01837) | - | 1967229..1967771 (-) | 543 | WP_000185654.1 | dUTP pyrophosphatase | - |
| CGP90_RS10215 (CGP90_01838) | - | 1967776..1968012 (-) | 237 | WP_001065023.1 | DUF1024 family protein | - |
| CGP90_RS10220 (CGP90_01839) | - | 1968005..1968313 (-) | 309 | WP_000144710.1 | hypothetical protein | - |
| CGP90_RS10225 (CGP90_01840) | - | 1968310..1968657 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| CGP90_RS10230 (CGP90_01841) | - | 1968654..1969055 (-) | 402 | WP_000695762.1 | hypothetical protein | - |
| CGP90_RS10235 (CGP90_01842) | - | 1969068..1969316 (-) | 249 | WP_012068339.1 | SAV1978 family virulence-associated passenger protein | - |
| CGP90_RS10240 (CGP90_01843) | - | 1969316..1969570 (-) | 255 | WP_000022735.1 | DUF3310 domain-containing protein | - |
| CGP90_RS10250 (CGP90_01844) | - | 1969656..1969841 (-) | 186 | WP_001187230.1 | DUF3113 family protein | - |
| CGP90_RS10255 (CGP90_01845) | - | 1969846..1970250 (-) | 405 | WP_031895320.1 | DUF1064 domain-containing protein | - |
| CGP90_RS10260 (CGP90_01846) | - | 1970247..1970672 (-) | 426 | WP_000451861.1 | phage N-6-adenine-methyltransferase | - |
| CGP90_RS10265 (CGP90_01847) | - | 1970682..1970903 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| CGP90_RS10270 (CGP90_01848) | - | 1970907..1971122 (-) | 216 | WP_001024405.1 | hypothetical protein | - |
| CGP90_RS10275 (CGP90_01849) | - | 1971119..1972360 (-) | 1242 | WP_015445891.1 | DnaB helicase C-terminal domain-containing protein | - |
| CGP90_RS10280 (CGP90_01850) | - | 1972357..1972713 (-) | 357 | WP_001132243.1 | hypothetical protein | - |
| CGP90_RS10285 (CGP90_01851) | - | 1972713..1973468 (-) | 756 | WP_001037657.1 | DnaD domain protein | - |
| CGP90_RS10290 (CGP90_01852) | - | 1973461..1974135 (-) | 675 | WP_015445893.1 | putative HNHc nuclease | - |
| CGP90_RS10295 (CGP90_01853) | - | 1974136..1974687 (-) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| CGP90_RS10300 (CGP90_01854) | ssbA | 1974698..1975123 (-) | 426 | WP_000934384.1 | single-stranded DNA-binding protein | Machinery gene |
| CGP90_RS10305 (CGP90_01855) | - | 1975123..1975746 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| CGP90_RS10310 (CGP90_01856) | - | 1975739..1975960 (-) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| CGP90_RS10315 (CGP90_01857) | - | 1975970..1976230 (-) | 261 | WP_000291076.1 | DUF1108 family protein | - |
| CGP90_RS10320 (CGP90_01858) | - | 1976324..1976485 (-) | 162 | WP_000066026.1 | DUF1270 family protein | - |
| CGP90_RS15390 (CGP90_01859) | - | 1976478..1976615 (-) | 138 | WP_000230552.1 | hypothetical protein | - |
| CGP90_RS10325 (CGP90_01860) | - | 1976665..1976895 (+) | 231 | WP_000395455.1 | hypothetical protein | - |
| CGP90_RS15395 (CGP90_01861) | - | 1976870..1977046 (-) | 177 | WP_172844570.1 | hypothetical protein | - |
| CGP90_RS10330 (CGP90_01862) | - | 1977062..1977814 (-) | 753 | WP_023487064.1 | phage antirepressor KilAC domain-containing protein | - |
| CGP90_RS10335 (CGP90_01863) | - | 1977816..1978001 (-) | 186 | WP_000933363.1 | helix-turn-helix transcriptional regulator | - |
| CGP90_RS10340 (CGP90_01864) | - | 1978441..1978650 (+) | 210 | WP_000642492.1 | hypothetical protein | - |
| CGP90_RS10345 (CGP90_01865) | - | 1978640..1978783 (-) | 144 | WP_000939498.1 | hypothetical protein | - |
| CGP90_RS10350 (CGP90_01866) | - | 1978798..1979241 (-) | 444 | WP_023487065.1 | hypothetical protein | - |
| CGP90_RS10355 (CGP90_01867) | - | 1979254..1979502 (-) | 249 | WP_000272859.1 | helix-turn-helix transcriptional regulator | - |
| CGP90_RS10360 (CGP90_01868) | - | 1979666..1979989 (+) | 324 | WP_001260487.1 | helix-turn-helix transcriptional regulator | - |
| CGP90_RS10365 (CGP90_01869) | - | 1980002..1980466 (+) | 465 | WP_000525007.1 | hypothetical protein | - |
| CGP90_RS10370 (CGP90_01870) | - | 1980498..1981178 (+) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CGP90_RS10375 (CGP90_01871) | - | 1981385..1982770 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
| CGP90_RS10380 (CGP90_01872) | rpmF | 1982887..1983060 (-) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| CGP90_RS10390 (CGP90_01873) | - | 1983140..1983697 (-) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| CGP90_RS10395 (CGP90_01874) | - | 1983824..1984963 (+) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| CGP90_RS10400 (CGP90_01875) | coaD | 1985025..1985507 (-) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| CGP90_RS10405 (CGP90_01876) | rsmD | 1985509..1986051 (-) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| CGP90_RS10410 (CGP90_01877) | - | 1986121..1986510 (+) | 390 | WP_000814565.1 | hypothetical protein | - |
| CGP90_RS10415 (CGP90_01878) | - | 1986513..1986767 (-) | 255 | WP_001049150.1 | YlbG family protein | - |
| CGP90_RS10420 (CGP90_01879) | - | 1987006..1987932 (+) | 927 | WP_000757575.1 | glycerophosphodiester phosphodiesterase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15784.48 Da Isoelectric Point: 8.4826
>NTDB_id=242795 CGP90_RS10300 WP_000934384.1 1974698..1975123(-) (ssbA) [Staphylococcus aureus strain 191]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=242795 CGP90_RS10300 WP_000934384.1 1974698..1975123(-) (ssbA) [Staphylococcus aureus strain 191]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
73.729 |
83.688 |
0.617 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.844 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
46.087 |
81.56 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.068 |
83.688 |
0.369 |