Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | S101189_RS04230 | Genome accession | NZ_CP021529 |
| Coordinates | 875811..876257 (+) | Length | 148 a.a. |
| NCBI ID | WP_065124802.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain SRCM101189 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 865353..905776 | 875811..876257 | within | 0 |
Gene organization within MGE regions
Location: 865353..905776
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S101189_RS04150 (S101189_00829) | - | 865353..866264 (-) | 912 | WP_232457162.1 | integrase | - |
| S101189_RS04155 (S101189_00830) | - | 866362..867168 (-) | 807 | WP_065124812.1 | DUF3037 domain-containing protein | - |
| S101189_RS04160 (S101189_00831) | - | 867170..868021 (-) | 852 | WP_144235586.1 | HipA family kinase | - |
| S101189_RS04165 (S101189_00832) | - | 868036..869232 (-) | 1197 | WP_081276412.1 | Ltp family lipoprotein | - |
| S101189_RS04170 (S101189_00833) | - | 869305..869712 (-) | 408 | WP_065124811.1 | ImmA/IrrE family metallo-endopeptidase | - |
| S101189_RS04175 (S101189_00834) | - | 869724..870086 (-) | 363 | WP_008840853.1 | helix-turn-helix domain-containing protein | - |
| S101189_RS04180 (S101189_00835) | - | 870229..870459 (+) | 231 | WP_065124810.1 | helix-turn-helix transcriptional regulator | - |
| S101189_RS10455 (S101189_00836) | - | 870456..870593 (+) | 138 | WP_008840855.1 | hypothetical protein | - |
| S101189_RS04185 (S101189_00837) | - | 870596..870820 (-) | 225 | WP_065124809.1 | hypothetical protein | - |
| S101189_RS04190 (S101189_00838) | - | 870887..871102 (+) | 216 | WP_065124808.1 | hypothetical protein | - |
| S101189_RS04195 (S101189_00839) | - | 871187..871651 (+) | 465 | WP_232457163.1 | helix-turn-helix domain-containing protein | - |
| S101189_RS04200 (S101189_00840) | - | 871652..871933 (+) | 282 | WP_065124807.1 | hypothetical protein | - |
| S101189_RS10460 (S101189_00841) | - | 871935..872078 (+) | 144 | WP_157420393.1 | hypothetical protein | - |
| S101189_RS04205 (S101189_00843) | - | 872171..873064 (+) | 894 | WP_065124806.1 | DUF1351 domain-containing protein | - |
| S101189_RS04210 (S101189_00844) | - | 873067..873903 (+) | 837 | WP_065124805.1 | ERF family protein | - |
| S101189_RS04215 (S101189_00845) | - | 873896..874729 (+) | 834 | WP_065124804.1 | helix-turn-helix domain-containing protein | - |
| S101189_RS04220 (S101189_00846) | - | 874734..875456 (+) | 723 | WP_021361655.1 | putative HNHc nuclease | - |
| S101189_RS04225 (S101189_00847) | - | 875413..875808 (+) | 396 | WP_157421136.1 | hypothetical protein | - |
| S101189_RS04230 (S101189_00848) | ssb | 875811..876257 (+) | 447 | WP_065124802.1 | single-stranded DNA-binding protein | Machinery gene |
| S101189_RS04235 (S101189_00849) | - | 876268..876615 (+) | 348 | WP_065124801.1 | DUF1642 domain-containing protein | - |
| S101189_RS04240 (S101189_00850) | - | 876612..876836 (+) | 225 | WP_065124800.1 | hypothetical protein | - |
| S101189_RS10465 (S101189_00851) | - | 876856..877014 (+) | 159 | WP_153903504.1 | hypothetical protein | - |
| S101189_RS04245 (S101189_00853) | - | 877354..877785 (+) | 432 | WP_065124799.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| S101189_RS04255 (S101189_00855) | - | 878398..879066 (+) | 669 | WP_065124798.1 | hypothetical protein | - |
| S101189_RS04260 (S101189_00856) | - | 879135..879821 (+) | 687 | WP_032540563.1 | terminase gpP N-terminus-related DNA-binding protein | - |
| S101189_RS04265 (S101189_00857) | - | 879787..881118 (+) | 1332 | WP_232460199.1 | PBSX family phage terminase large subunit | - |
| S101189_RS04270 (S101189_00858) | - | 881130..882659 (+) | 1530 | WP_050585101.1 | phage portal protein | - |
| S101189_RS04275 (S101189_00859) | - | 882656..883789 (+) | 1134 | WP_081276410.1 | phage minor capsid protein | - |
| S101189_RS04280 (S101189_00860) | - | 883889..884461 (+) | 573 | WP_021361667.1 | phage scaffolding protein | - |
| S101189_RS04285 (S101189_00861) | - | 884474..885343 (+) | 870 | WP_065124797.1 | capsid protein | - |
| S101189_RS04290 (S101189_00862) | - | 885414..885830 (+) | 417 | WP_065124796.1 | hypothetical protein | - |
| S101189_RS04295 (S101189_00863) | - | 885827..886177 (+) | 351 | WP_065124795.1 | putative minor capsid protein | - |
| S101189_RS04300 (S101189_00864) | - | 886177..886521 (+) | 345 | WP_065124794.1 | minor capsid protein | - |
| S101189_RS04305 (S101189_00865) | - | 886521..886916 (+) | 396 | WP_065124793.1 | phage tail terminator protein | - |
| S101189_RS04310 (S101189_00866) | - | 887040..887471 (+) | 432 | Protein_821 | phage tail tube protein | - |
| S101189_RS04315 (S101189_00867) | - | 887545..888012 (+) | 468 | WP_065124791.1 | Ig-like domain-containing protein | - |
| S101189_RS04320 (S101189_00868) | - | 888088..888480 (+) | 393 | WP_065124790.1 | hypothetical protein | - |
| S101189_RS04325 (S101189_00869) | - | 888490..889110 (+) | 621 | WP_065124789.1 | Gp15 family bacteriophage protein | - |
| S101189_RS04330 (S101189_00870) | - | 889144..894261 (+) | 5118 | WP_065124788.1 | tape measure protein | - |
| S101189_RS04335 (S101189_00871) | - | 894263..895087 (+) | 825 | WP_065124787.1 | phage tail domain-containing protein | - |
| S101189_RS04340 (S101189_00872) | - | 895099..896214 (+) | 1116 | WP_065124786.1 | prophage endopeptidase tail family protein | - |
| S101189_RS04345 (S101189_00873) | - | 896207..896437 (+) | 231 | WP_065124785.1 | hypothetical protein | - |
| S101189_RS04350 (S101189_00874) | - | 896418..896828 (+) | 411 | WP_065124784.1 | hypothetical protein | - |
| S101189_RS04355 (S101189_00875) | - | 896818..897855 (+) | 1038 | WP_065124783.1 | BppU family phage baseplate upper protein | - |
| S101189_RS04360 (S101189_00876) | - | 897868..898689 (+) | 822 | WP_065124782.1 | collagen-like protein | - |
| S101189_RS04365 (S101189_00877) | - | 898705..900195 (+) | 1491 | WP_065124781.1 | hypothetical protein | - |
| S101189_RS04370 (S101189_00878) | - | 900271..900516 (+) | 246 | WP_144235585.1 | hypothetical protein | - |
| S101189_RS04375 (S101189_00879) | - | 900516..900770 (+) | 255 | WP_065124779.1 | phage holin | - |
| S101189_RS04380 (S101189_00880) | - | 900754..902121 (+) | 1368 | WP_065124778.1 | GH25 family lysozyme | - |
| S101189_RS04385 (S101189_00881) | - | 902149..902748 (+) | 600 | WP_065124777.1 | GH25 family lysozyme | - |
| S101189_RS04395 (S101189_00882) | - | 903207..903527 (+) | 321 | WP_065124775.1 | acetyl-CoA carboxylase | - |
| S101189_RS10630 (S101189_00883) | - | 903872..904756 (-) | 885 | WP_232457164.1 | hypothetical protein | - |
| S101189_RS04405 (S101189_00884) | - | 904877..905776 (-) | 900 | WP_065124774.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16646.32 Da Isoelectric Point: 5.7209
>NTDB_id=231899 S101189_RS04230 WP_065124802.1 875811..876257(+) (ssb) [Pediococcus acidilactici strain SRCM101189]
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENFCNFTHKGSLVGIDGRIQTS
SYEKEGQRVYATQVVVDSFSLLEPKQQSQQRGQQSNASDALHNNFGQPTNNYSQNNNDFGIDDNDLPF
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENFCNFTHKGSLVGIDGRIQTS
SYEKEGQRVYATQVVVDSFSLLEPKQQSQQRGQQSNASDALHNNFGQPTNNYSQNNNDFGIDDNDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=231899 S101189_RS04230 WP_065124802.1 875811..876257(+) (ssb) [Pediococcus acidilactici strain SRCM101189]
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGGCAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTCTGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGATGGTCGGATTCAAACTAGT
TCGTACGAAAAGGAAGGTCAACGCGTGTATGCTACACAAGTGGTTGTAGATAGTTTCTCGTTGCTTGAACCAAAGCAACA
AAGCCAACAACGTGGCCAGCAATCCAACGCTAGCGATGCTTTGCATAACAATTTCGGACAACCTACTAACAATTATAGCC
AGAATAATAACGATTTCGGCATCGACGATAATGATTTGCCGTTTTAG
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGGCAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTCTGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGATGGTCGGATTCAAACTAGT
TCGTACGAAAAGGAAGGTCAACGCGTGTATGCTACACAAGTGGTTGTAGATAGTTTCTCGTTGCTTGAACCAAAGCAACA
AAGCCAACAACGTGGCCAGCAATCCAACGCTAGCGATGCTTTGCATAACAATTTCGGACAACCTACTAACAATTATAGCC
AGAATAATAACGATTTCGGCATCGACGATAATGATTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.706 |
100 |
0.628 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.837 |
100 |
0.568 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.455 |
74.324 |
0.412 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.514 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.838 |
100 |
0.378 |
| ssb | Vibrio cholerae strain A1552 |
31.977 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.162 |
100 |
0.372 |