Detailed information NTG0216568

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: BXP64_RS07445
• Genome accession: NZ_CP019591
• Coordinates: 1519433..1519735 (-)
• Length: 100 a.a.
• NCBI ID: WP_029657948.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 293G
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1514433..1524735

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BXP64_RS07410 (BXP64_07465)	gcvPA	1514935..1516281 (-)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
BXP64_RS07415 (BXP64_07470)	gcvT	1516301..1517392 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
BXP64_RS07420 (BXP64_07475)	-	1517551..1518075 (-)	525	WP_001015120.1	shikimate kinase	-
BXP64_RS07425 (BXP64_07480)	-	1518065..1518211 (-)	147	WP_001789879.1	hypothetical protein	-
BXP64_RS07430 (BXP64_07485)	comGF	1518308..1518805 (-)	498	WP_001825340.1	competence type IV pilus minor pilin ComGF	Machinery gene
BXP64_RS07435 (BXP64_07490)	comGE	1518723..1519022 (-)	300	WP_174220558.1	competence protein ComGE	Machinery gene
BXP64_RS07440 (BXP64_07495)	comGD	1519009..1519455 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
BXP64_RS07445 (BXP64_07500)	comGC	1519433..1519735 (-)	303	WP_029657948.1	competence type IV pilus major pilin ComGC	Machinery gene
BXP64_RS07450 (BXP64_07505)	comGB	1519757..1520827 (-)	1071	WP_000776425.1	competence type IV pilus assembly protein ComGB	Machinery gene
BXP64_RS07455 (BXP64_07510)	comGA	1520799..1521773 (-)	975	WP_031872164.1	competence type IV pilus ATPase ComGA	Machinery gene
BXP64_RS07460 (BXP64_07515)	-	1521825..1522448 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
BXP64_RS07465 (BXP64_07520)	-	1522445..1522774 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
BXP64_RS07470 (BXP64_07525)	-	1522774..1523760 (-)	987	WP_000161315.1	ROK family glucokinase	-
BXP64_RS07475 (BXP64_07530)	-	1523757..1523960 (-)	204	WP_000087559.1	YqgQ family protein	-

Sequence

Protein

• Length: 100 a.a.
• Molecular weight: 10866.75 Da
• Isoelectric Point: 7.8607

>NTDB_id=216568 BXP64_RS07445 WP_029657948.1 1519433..1519735(-) (comGC) [Staphylococcus aureus strain 293G]
MSKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFIKEA
QKTCKSGETITISNGEAVAN

Nucleotide

• Length: 303 bp

>NTDB_id=216568 BXP64_RS07445 WP_029657948.1 1519433..1519735(-) (comGC) [Staphylococcus aureus strain 293G]
ATTTCTAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATTAATTTTAAT
CATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTAATAGTCAAA
TTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATAAAAGAAGCA
CAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	100	98	0.98
comGC	Staphylococcus aureus MW2	100	98	0.98
comGC/cglC	Streptococcus mitis SK321	46.809	94	0.44
comGC/cglC	Streptococcus pneumoniae R6	45.745	94	0.43
comGC/cglC	Streptococcus pneumoniae D39	45.745	94	0.43
comGC/cglC	Streptococcus pneumoniae TIGR4	45.745	94	0.43
comGC/cglC	Streptococcus pneumoniae Rx1	45.745	94	0.43
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	98	0.42
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	78	0.4
comYC	Streptococcus suis isolate S10	50	78	0.39
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	91	0.38
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	82	0.38
comYC	Streptococcus mutans UA140	48.684	76	0.37
comYC	Streptococcus mutans UA159	48.684	76	0.37