Detailed information NTG0216372

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: BZP34_RS02735
• Genome accession: NZ_CP019563
• Coordinates: 480178..480489 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SR434
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 475178..485489

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BZP34_RS02705 (BZP34_02705)	-	475961..476164 (+)	204	WP_000087561.1	YqgQ family protein	-
BZP34_RS02710 (BZP34_02710)	-	476161..477147 (+)	987	WP_000161315.1	ROK family glucokinase	-
BZP34_RS02715 (BZP34_02715)	-	477147..477476 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
BZP34_RS02720 (BZP34_02720)	-	477473..478096 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
BZP34_RS02725 (BZP34_02725)	comGA	478148..479122 (+)	975	WP_000697219.1	competence type IV pilus ATPase ComGA	Machinery gene
BZP34_RS02730 (BZP34_02730)	comGB	479094..480164 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
BZP34_RS02735 (BZP34_02735)	comGC	480178..480489 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
BZP34_RS02740 (BZP34_02740)	comGD	480467..480913 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
BZP34_RS02745 (BZP34_02745)	comGE	480900..481199 (+)	300	WP_000844410.1	hypothetical protein	Machinery gene
BZP34_RS02750 (BZP34_02750)	comGF	481117..481614 (+)	498	WP_029694050.1	competence type IV pilus minor pilin ComGF	Machinery gene
BZP34_RS02755 (BZP34_02755)	-	481711..481857 (+)	147	WP_001789879.1	hypothetical protein	-
BZP34_RS02760 (BZP34_02760)	-	481847..482371 (+)	525	WP_001015121.1	shikimate kinase	-
BZP34_RS02765 (BZP34_02765)	gcvT	482530..483621 (+)	1092	WP_000093345.1	glycine cleavage system aminomethyltransferase GcvT	-
BZP34_RS02770 (BZP34_02770)	gcvPA	483641..484987 (+)	1347	WP_077156047.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=216372 BZP34_RS02735 WP_000472256.1 480178..480489(+) (comGC) [Staphylococcus aureus strain SR434]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=216372 BZP34_RS02735 WP_000472256.1 480178..480489(+) (comGC) [Staphylococcus aureus strain SR434]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369