Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | A9176_RS06045 | Genome accession | NZ_CP016329 |
| Coordinates | 1185723..1186133 (+) | Length | 136 a.a. |
| NCBI ID | WP_077282594.1 | Uniprot ID | - |
| Organism | Leuconostoc garlicum strain KFRI01 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1163545..1191646 | 1185723..1186133 | within | 0 |
Gene organization within MGE regions
Location: 1163545..1191646
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9176_RS05915 (A9176_05885) | - | 1163545..1163820 (+) | 276 | WP_010000207.1 | HU family DNA-binding protein | - |
| A9176_RS05920 (A9176_05890) | - | 1164083..1164310 (+) | 228 | WP_010000206.1 | CsbD family protein | - |
| A9176_RS05925 (A9176_05895) | - | 1164512..1165777 (+) | 1266 | WP_077282558.1 | tetratricopeptide repeat protein | - |
| A9176_RS05930 (A9176_05900) | - | 1165873..1167078 (+) | 1206 | WP_077282560.1 | CCA tRNA nucleotidyltransferase | - |
| A9176_RS05935 (A9176_05905) | - | 1167071..1167571 (+) | 501 | WP_029509284.1 | dihydrofolate reductase | - |
| A9176_RS05940 (A9176_05910) | - | 1167579..1168430 (+) | 852 | WP_077282562.1 | DegV family protein | - |
| A9176_RS05945 (A9176_05915) | - | 1168573..1169265 (+) | 693 | WP_242943201.1 | SGNH/GDSL hydrolase family protein | - |
| A9176_RS05950 (A9176_05920) | - | 1169301..1170332 (-) | 1032 | WP_077282566.1 | lactonase family protein | - |
| A9176_RS05955 (A9176_05925) | - | 1170455..1171618 (+) | 1164 | WP_077282568.1 | DNA repair exonuclease | - |
| A9176_RS05960 (A9176_05930) | - | 1171624..1173987 (+) | 2364 | WP_077282570.1 | AAA family ATPase | - |
| A9176_RS05965 (A9176_05935) | - | 1174003..1174950 (+) | 948 | WP_077282572.1 | HD domain-containing protein | - |
| A9176_RS05970 (A9176_05940) | - | 1174984..1175895 (-) | 912 | WP_029509293.1 | peptidyl-prolyl cis-trans isomerase | - |
| A9176_RS05975 (A9176_05945) | - | 1175950..1176189 (-) | 240 | WP_029509294.1 | hypothetical protein | - |
| A9176_RS05980 (A9176_05950) | - | 1176195..1176626 (-) | 432 | WP_010000190.1 | HIT family protein | - |
| A9176_RS05985 (A9176_05955) | - | 1176697..1177440 (+) | 744 | WP_077282574.1 | ABC transporter ATP-binding protein | - |
| A9176_RS05990 (A9176_05960) | - | 1177427..1178698 (+) | 1272 | WP_198150920.1 | ABC transporter permease | - |
| A9176_RS05995 (A9176_05965) | trmB | 1178746..1179405 (+) | 660 | WP_029509297.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| A9176_RS06000 (A9176_05970) | - | 1179860..1180426 (-) | 567 | WP_077282578.1 | hypothetical protein | - |
| A9176_RS06005 (A9176_05975) | - | 1180538..1180768 (-) | 231 | WP_077282580.1 | hypothetical protein | - |
| A9176_RS06010 (A9176_05980) | - | 1181160..1182203 (-) | 1044 | WP_077282582.1 | site-specific integrase | - |
| A9176_RS06015 (A9176_05985) | - | 1182373..1182987 (-) | 615 | WP_077282584.1 | DUF4352 domain-containing protein | - |
| A9176_RS06020 (A9176_05990) | - | 1183052..1183561 (-) | 510 | WP_077282586.1 | S24 family peptidase | - |
| A9176_RS06025 (A9176_05995) | - | 1183630..1183872 (+) | 243 | WP_004912700.1 | transposase | - |
| A9176_RS06030 (A9176_06000) | - | 1183918..1184724 (+) | 807 | WP_198150921.1 | IS3 family transposase | - |
| A9176_RS06035 (A9176_06005) | - | 1184773..1185120 (+) | 348 | WP_077282590.1 | hypothetical protein | - |
| A9176_RS06040 (A9176_06010) | - | 1185113..1185736 (+) | 624 | WP_077282592.1 | ERF family protein | - |
| A9176_RS06045 (A9176_06015) | ssb | 1185723..1186133 (+) | 411 | WP_077282594.1 | single-stranded DNA-binding protein | Machinery gene |
| A9176_RS06050 (A9176_06020) | - | 1186145..1186840 (+) | 696 | WP_077282596.1 | putative HNHc nuclease | - |
| A9176_RS06055 (A9176_06025) | - | 1186892..1187296 (+) | 405 | WP_077282599.1 | dTDP-glucose pyrophosphorylase | - |
| A9176_RS08735 | - | 1187286..1187444 (+) | 159 | WP_157093699.1 | hypothetical protein | - |
| A9176_RS06060 (A9176_06030) | - | 1187446..1187727 (+) | 282 | WP_077282601.1 | helix-turn-helix transcriptional regulator | - |
| A9176_RS06070 (A9176_06040) | - | 1187918..1188130 (+) | 213 | WP_077282605.1 | hypothetical protein | - |
| A9176_RS06075 (A9176_06045) | - | 1188321..1188713 (+) | 393 | WP_077282607.1 | DUF722 domain-containing protein | - |
| A9176_RS08740 | - | 1189400..1189570 (+) | 171 | WP_157093700.1 | hypothetical protein | - |
| A9176_RS06085 (A9176_06055) | - | 1189619..1189798 (+) | 180 | WP_077282609.1 | hypothetical protein | - |
| A9176_RS06090 (A9176_06060) | - | 1189800..1190843 (+) | 1044 | WP_077282611.1 | metallophosphoesterase | - |
| A9176_RS06095 (A9176_06065) | - | 1190840..1191646 (-) | 807 | WP_198150922.1 | IS3 family transposase | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 15022.52 Da Isoelectric Point: 5.1515
>NTDB_id=186978 A9176_RS06045 WP_077282594.1 1185723..1186133(+) (ssb) [Leuconostoc garlicum strain KFRI01]
MNQVNLTGRLTKDIELRYTQSGKAVASGSIAVNRRFKSEGQPDADFINFVMWGKTAENFANYTHKGSQVGLGGEWQTRNY
ENNNGQRVYVNELNATSFDLLDPRGATQTQSNLDSVDPFAAAGKKQIDISDDALPF
MNQVNLTGRLTKDIELRYTQSGKAVASGSIAVNRRFKSEGQPDADFINFVMWGKTAENFANYTHKGSQVGLGGEWQTRNY
ENNNGQRVYVNELNATSFDLLDPRGATQTQSNLDSVDPFAAAGKKQIDISDDALPF
Nucleotide
Download Length: 411 bp
>NTDB_id=186978 A9176_RS06045 WP_077282594.1 1185723..1186133(+) (ssb) [Leuconostoc garlicum strain KFRI01]
ATGAACCAAGTTAATTTAACAGGACGACTAACAAAAGACATCGAATTACGCTACACACAATCGGGTAAAGCAGTGGCCAG
CGGATCTATTGCGGTTAATCGGCGGTTTAAGTCGGAAGGTCAACCTGATGCAGACTTCATCAACTTCGTGATGTGGGGCA
AGACGGCTGAAAACTTTGCTAACTACACACACAAAGGGTCACAAGTTGGATTAGGTGGCGAGTGGCAGACGCGGAACTAC
GAGAACAACAACGGGCAACGTGTTTACGTGAACGAGCTAAATGCAACAAGTTTTGATTTGCTTGATCCACGAGGCGCAAC
GCAAACACAAAGCAACTTAGATAGCGTTGATCCGTTTGCGGCAGCGGGTAAAAAACAAATCGACATTTCAGACGATGCGC
TGCCCTTCTAA
ATGAACCAAGTTAATTTAACAGGACGACTAACAAAAGACATCGAATTACGCTACACACAATCGGGTAAAGCAGTGGCCAG
CGGATCTATTGCGGTTAATCGGCGGTTTAAGTCGGAAGGTCAACCTGATGCAGACTTCATCAACTTCGTGATGTGGGGCA
AGACGGCTGAAAACTTTGCTAACTACACACACAAAGGGTCACAAGTTGGATTAGGTGGCGAGTGGCAGACGCGGAACTAC
GAGAACAACAACGGGCAACGTGTTTACGTGAACGAGCTAAATGCAACAAGTTTTGATTTGCTTGATCCACGAGGCGCAAC
GCAAACACAAAGCAACTTAGATAGCGTTGATCCGTTTGCGGCAGCGGGTAAAAAACAAATCGACATTTCAGACGATGCGC
TGCCCTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.235 |
100 |
0.603 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
44.767 |
100 |
0.566 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.029 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.029 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.029 |
100 |
0.426 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.647 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.304 |
100 |
0.419 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.304 |
100 |
0.419 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.304 |
100 |
0.419 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.846 |
76.471 |
0.412 |
| ssbA | Streptococcus mutans UA159 |
39.706 |
100 |
0.397 |