Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A7P66_RS06950 | Genome accession | NZ_CP015645 |
| Coordinates | 1349283..1349711 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain 08-02119 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1314551..1358714 | 1349283..1349711 | within | 0 |
Gene organization within MGE regions
Location: 1314551..1358714
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7P66_RS06705 (A7P66_06705) | eta | 1314551..1315393 (-) | 843 | WP_001065781.1 | exfoliative toxin A | - |
| A7P66_RS06710 (A7P66_06710) | - | 1315520..1316932 (-) | 1413 | WP_001141515.1 | N-acetylmuramoyl-L-alanine amidase | - |
| A7P66_RS06715 (A7P66_06715) | - | 1316919..1317194 (-) | 276 | WP_000351119.1 | phage holin | - |
| A7P66_RS06720 (A7P66_06720) | - | 1317250..1317645 (-) | 396 | WP_000398858.1 | hypothetical protein | - |
| A7P66_RS06725 (A7P66_06725) | - | 1317651..1318889 (-) | 1239 | WP_000276657.1 | BppU family phage baseplate upper protein | - |
| A7P66_RS06730 (A7P66_06730) | - | 1318902..1320776 (-) | 1875 | WP_000524050.1 | glucosaminidase domain-containing protein | - |
| A7P66_RS06735 (A7P66_06735) | - | 1320913..1321212 (-) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| A7P66_RS06740 (A7P66_06740) | - | 1321253..1321426 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| A7P66_RS06745 (A7P66_06745) | - | 1321430..1321807 (-) | 378 | WP_000705915.1 | DUF2977 domain-containing protein | - |
| A7P66_RS06750 (A7P66_06750) | - | 1321807..1323630 (-) | 1824 | WP_000259635.1 | phage baseplate upper protein | - |
| A7P66_RS06755 (A7P66_06755) | - | 1323630..1325528 (-) | 1899 | WP_000323240.1 | hypothetical protein | - |
| A7P66_RS06760 (A7P66_06760) | - | 1325541..1327427 (-) | 1887 | WP_029549389.1 | SGNH/GDSL hydrolase family protein | - |
| A7P66_RS06765 (A7P66_06765) | - | 1327438..1328379 (-) | 942 | WP_000560181.1 | phage tail domain-containing protein | - |
| A7P66_RS06770 (A7P66_06770) | - | 1328394..1331279 (-) | 2886 | WP_000379446.1 | hypothetical protein | - |
| A7P66_RS14995 | - | 1331283..1331432 (-) | 150 | WP_000617400.1 | hypothetical protein | - |
| A7P66_RS06775 (A7P66_06775) | - | 1331612..1332118 (-) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| A7P66_RS06780 (A7P66_06780) | - | 1332185..1332742 (-) | 558 | WP_000057583.1 | hypothetical protein | - |
| A7P66_RS06785 (A7P66_06785) | - | 1332743..1333168 (-) | 426 | WP_000270190.1 | DUF3168 domain-containing protein | - |
| A7P66_RS06790 (A7P66_06790) | - | 1333181..1333588 (-) | 408 | WP_031836888.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| A7P66_RS06795 (A7P66_06795) | - | 1333575..1333910 (-) | 336 | WP_000483041.1 | phage head closure protein | - |
| A7P66_RS06800 (A7P66_06800) | - | 1333922..1334272 (-) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| A7P66_RS15000 | - | 1334278..1334421 (-) | 144 | WP_000002931.1 | hypothetical protein | - |
| A7P66_RS06805 (A7P66_06805) | - | 1334433..1335347 (-) | 915 | WP_000235168.1 | phage major capsid protein | - |
| A7P66_RS06810 (A7P66_06810) | - | 1335364..1335948 (-) | 585 | WP_001019219.1 | DUF4355 domain-containing protein | - |
| A7P66_RS06815 (A7P66_06815) | - | 1336044..1336994 (-) | 951 | WP_000184132.1 | phage head morphogenesis protein | - |
| A7P66_RS06820 (A7P66_06820) | - | 1336963..1338387 (-) | 1425 | WP_000177426.1 | phage portal protein | - |
| A7P66_RS06825 (A7P66_06825) | - | 1338384..1339607 (-) | 1224 | WP_001037585.1 | PBSX family phage terminase large subunit | - |
| A7P66_RS06830 (A7P66_06830) | - | 1339600..1340094 (-) | 495 | WP_000594088.1 | terminase small subunit | - |
| A7P66_RS06835 (A7P66_06835) | - | 1340447..1340848 (-) | 402 | WP_000286968.1 | hypothetical protein | - |
| A7P66_RS06840 (A7P66_06840) | rinB | 1340849..1341022 (-) | 174 | WP_000595259.1 | transcriptional activator RinB | - |
| A7P66_RS06845 (A7P66_06845) | - | 1341069..1341593 (-) | 525 | WP_031836885.1 | hypothetical protein | - |
| A7P66_RS06850 (A7P66_06850) | - | 1341642..1341926 (-) | 285 | WP_223289268.1 | hypothetical protein | - |
| A7P66_RS06855 (A7P66_06855) | - | 1341963..1342496 (-) | 534 | WP_031836883.1 | dUTP diphosphatase | - |
| A7P66_RS06860 (A7P66_06860) | - | 1342489..1342737 (-) | 249 | WP_031836882.1 | DUF1024 family protein | - |
| A7P66_RS06865 (A7P66_06865) | - | 1342730..1342927 (-) | 198 | WP_094321643.1 | hypothetical protein | - |
| A7P66_RS06870 (A7P66_06870) | - | 1342930..1343433 (-) | 504 | WP_031928724.1 | hypothetical protein | - |
| A7P66_RS06875 (A7P66_06875) | - | 1343430..1343882 (-) | 453 | WP_000982706.1 | YopX family protein | - |
| A7P66_RS06880 (A7P66_06880) | - | 1343879..1344073 (-) | 195 | WP_000983953.1 | hypothetical protein | - |
| A7P66_RS06885 (A7P66_06885) | - | 1344070..1344474 (-) | 405 | WP_031836912.1 | hypothetical protein | - |
| A7P66_RS06890 (A7P66_06890) | - | 1344477..1344683 (-) | 207 | WP_000693989.1 | hypothetical protein | - |
| A7P66_RS06895 (A7P66_06895) | - | 1344697..1344945 (-) | 249 | WP_060474161.1 | SAV1978 family virulence-associated passenger protein | - |
| A7P66_RS06900 (A7P66_06900) | - | 1344945..1345199 (-) | 255 | WP_000022736.1 | DUF3310 domain-containing protein | - |
| A7P66_RS06905 (A7P66_06905) | - | 1345199..1345561 (-) | 363 | WP_000536051.1 | SA1788 family PVL leukocidin-associated protein | - |
| A7P66_RS06910 (A7P66_06910) | - | 1345562..1345747 (-) | 186 | WP_031836911.1 | DUF3113 family protein | - |
| A7P66_RS06915 (A7P66_06915) | - | 1345747..1346154 (-) | 408 | WP_031836910.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A7P66_RS06920 (A7P66_06920) | - | 1346164..1346385 (-) | 222 | WP_001123674.1 | DUF3269 family protein | - |
| A7P66_RS06925 (A7P66_06925) | - | 1346398..1346556 (-) | 159 | WP_031836909.1 | hypothetical protein | - |
| A7P66_RS06930 (A7P66_06930) | - | 1346550..1347329 (-) | 780 | WP_031836908.1 | ATP-binding protein | - |
| A7P66_RS06935 (A7P66_06935) | - | 1347339..1348109 (-) | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
| A7P66_RS06940 (A7P66_06940) | - | 1348175..1348456 (+) | 282 | WP_000414755.1 | hypothetical protein | - |
| A7P66_RS15005 | - | 1348449..1348598 (-) | 150 | WP_001081076.1 | hypothetical protein | - |
| A7P66_RS06945 (A7P66_06945) | - | 1348595..1349269 (-) | 675 | WP_031836907.1 | putative HNHc nuclease | - |
| A7P66_RS06950 (A7P66_06950) | ssbA | 1349283..1349711 (-) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| A7P66_RS06955 (A7P66_06955) | - | 1349711..1350334 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| A7P66_RS06960 (A7P66_06960) | - | 1350327..1350548 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| A7P66_RS06965 (A7P66_06965) | - | 1350558..1350818 (-) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| A7P66_RS06970 (A7P66_06970) | - | 1350910..1351071 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| A7P66_RS06975 (A7P66_06975) | - | 1351064..1351285 (-) | 222 | WP_000977378.1 | hypothetical protein | - |
| A7P66_RS06980 (A7P66_06980) | - | 1351299..1351748 (-) | 450 | WP_001094943.1 | hypothetical protein | - |
| A7P66_RS06985 (A7P66_06985) | tscA | 1351788..1352012 (-) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| A7P66_RS06990 (A7P66_06990) | - | 1352013..1352780 (-) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| A7P66_RS06995 (A7P66_06995) | - | 1352780..1352974 (-) | 195 | WP_042909085.1 | helix-turn-helix domain-containing protein | - |
| A7P66_RS07000 (A7P66_07000) | - | 1353237..1353569 (+) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| A7P66_RS07005 (A7P66_07005) | - | 1353586..1354260 (+) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A7P66_RS07010 (A7P66_07010) | - | 1354288..1355013 (+) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| A7P66_RS07015 (A7P66_07015) | - | 1355045..1355950 (+) | 906 | Protein_1335 | hypothetical protein | - |
| A7P66_RS07020 (A7P66_07020) | - | 1355887..1356087 (-) | 201 | WP_000143212.1 | excisionase | - |
| A7P66_RS07025 (A7P66_07025) | - | 1356200..1357249 (+) | 1050 | WP_031836904.1 | tyrosine-type recombinase/integrase | - |
| A7P66_RS07030 (A7P66_07030) | sufB | 1357317..1358714 (-) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=181726 A7P66_RS06950 WP_000934385.1 1349283..1349711(-) (ssbA) [Staphylococcus aureus strain 08-02119]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=181726 A7P66_RS06950 WP_000934385.1 1349283..1349711(-) (ssbA) [Staphylococcus aureus strain 08-02119]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |