Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A2I68_RS04180 | Genome accession | NZ_CP015553 |
| Coordinates | 797012..797458 (+) | Length | 148 a.a. |
| NCBI ID | WP_046100579.1 | Uniprot ID | A0AAJ0JNB3 |
| Organism | Staphylococcus carnosus strain TMW 2.1596 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 782717..829878 | 797012..797458 | within | 0 |
Gene organization within MGE regions
Location: 782717..829878
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A2I68_RS04050 (A2I68_03940) | - | 782717..783226 (+) | 510 | WP_046100561.1 | metallophosphoesterase | - |
| A2I68_RS04055 (A2I68_03945) | - | 783281..783460 (-) | 180 | WP_046100562.1 | hypothetical protein | - |
| A2I68_RS04060 (A2I68_03950) | - | 783619..783996 (-) | 378 | WP_046100563.1 | VOC family protein | - |
| A2I68_RS04065 (A2I68_03955) | - | 784107..784559 (+) | 453 | Protein_789 | VOC family protein | - |
| A2I68_RS04070 (A2I68_03960) | - | 784730..785176 (+) | 447 | WP_015900029.1 | GNAT family N-acetyltransferase | - |
| A2I68_RS04075 (A2I68_03965) | - | 785273..785656 (-) | 384 | WP_046100564.1 | hypothetical protein | - |
| A2I68_RS04080 (A2I68_03970) | - | 785785..786279 (-) | 495 | WP_046100565.1 | hypothetical protein | - |
| A2I68_RS04085 (A2I68_03975) | - | 786464..787036 (+) | 573 | WP_052719486.1 | hypothetical protein | - |
| A2I68_RS04090 | - | 787624..788124 (+) | 501 | WP_235318616.1 | hypothetical protein | - |
| A2I68_RS04095 (A2I68_03985) | - | 788141..788614 (+) | 474 | WP_052719487.1 | hypothetical protein | - |
| A2I68_RS04100 (A2I68_03990) | - | 788662..789264 (+) | 603 | WP_052719488.1 | hypothetical protein | - |
| A2I68_RS04105 (A2I68_03995) | - | 789249..789602 (+) | 354 | WP_052719489.1 | HIRAN domain-containing protein | - |
| A2I68_RS04110 (A2I68_04000) | - | 789918..790946 (-) | 1029 | WP_046100566.1 | tyrosine-type recombinase/integrase | - |
| A2I68_RS04115 (A2I68_04005) | - | 791004..791684 (-) | 681 | WP_046100567.1 | VanZ family protein | - |
| A2I68_RS04120 (A2I68_04010) | - | 791738..792376 (-) | 639 | WP_046100568.1 | XRE family transcriptional regulator | - |
| A2I68_RS04125 (A2I68_04015) | - | 792569..792823 (+) | 255 | WP_046100569.1 | helix-turn-helix transcriptional regulator | - |
| A2I68_RS04130 (A2I68_04020) | - | 792837..793778 (+) | 942 | WP_046100570.1 | DUF3102 domain-containing protein | - |
| A2I68_RS04135 (A2I68_04025) | - | 793887..794327 (+) | 441 | WP_052719490.1 | ORF6C domain-containing protein | - |
| A2I68_RS04140 (A2I68_04030) | - | 794361..794570 (+) | 210 | WP_046100572.1 | hypothetical protein | - |
| A2I68_RS04145 (A2I68_04035) | - | 794582..794782 (+) | 201 | WP_046100573.1 | hypothetical protein | - |
| A2I68_RS04150 (A2I68_04045) | - | 795189..795395 (-) | 207 | WP_046100574.1 | hypothetical protein | - |
| A2I68_RS04155 (A2I68_04050) | - | 795455..795685 (+) | 231 | WP_046100575.1 | DUF771 domain-containing protein | - |
| A2I68_RS04160 (A2I68_04055) | - | 795682..795864 (+) | 183 | WP_046100576.1 | hypothetical protein | - |
| A2I68_RS04165 (A2I68_04060) | - | 795922..796167 (+) | 246 | WP_046100577.1 | hypothetical protein | - |
| A2I68_RS04170 (A2I68_04065) | - | 796160..796420 (+) | 261 | WP_015899731.1 | DUF2483 family protein | - |
| A2I68_RS04175 (A2I68_04070) | - | 796377..797015 (+) | 639 | WP_046100578.1 | ERF family protein | - |
| A2I68_RS04180 (A2I68_04075) | ssbA | 797012..797458 (+) | 447 | WP_046100579.1 | single-stranded DNA-binding protein | Machinery gene |
| A2I68_RS04185 (A2I68_04080) | - | 797471..798148 (+) | 678 | WP_046100580.1 | putative HNHc nuclease | - |
| A2I68_RS04190 (A2I68_04085) | - | 798141..798488 (+) | 348 | WP_200894321.1 | hypothetical protein | - |
| A2I68_RS04195 (A2I68_04090) | - | 798481..799251 (+) | 771 | WP_046100582.1 | conserved phage C-terminal domain-containing protein | - |
| A2I68_RS04200 (A2I68_04095) | - | 799252..800037 (+) | 786 | WP_046100671.1 | ATP-binding protein | - |
| A2I68_RS04205 (A2I68_04100) | - | 800037..800219 (+) | 183 | WP_046100672.1 | hypothetical protein | - |
| A2I68_RS04210 (A2I68_04105) | - | 800203..800610 (+) | 408 | WP_046100673.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A2I68_RS04215 | - | 800619..800783 (+) | 165 | WP_162272179.1 | hypothetical protein | - |
| A2I68_RS04220 (A2I68_04110) | - | 800789..801319 (+) | 531 | WP_015899740.1 | hypothetical protein | - |
| A2I68_RS04225 (A2I68_04115) | - | 801320..801769 (+) | 450 | WP_052719496.1 | DUF3310 domain-containing protein | - |
| A2I68_RS04230 | - | 801762..802514 (+) | 753 | WP_082080549.1 | nucleoside 2-deoxyribosyltransferase | - |
| A2I68_RS04235 (A2I68_04125) | - | 802573..803073 (+) | 501 | WP_046099517.1 | dUTP pyrophosphatase | - |
| A2I68_RS04240 (A2I68_04130) | - | 803152..803469 (+) | 318 | WP_046099516.1 | hypothetical protein | - |
| A2I68_RS04245 (A2I68_04135) | - | 803656..804105 (+) | 450 | WP_046099515.1 | hypothetical protein | - |
| A2I68_RS04250 | - | 804105..804266 (+) | 162 | WP_156768892.1 | hypothetical protein | - |
| A2I68_RS04255 (A2I68_04140) | - | 804269..804460 (+) | 192 | WP_046099514.1 | hypothetical protein | - |
| A2I68_RS04260 | - | 804457..804591 (+) | 135 | WP_152648952.1 | transcriptional regulator | - |
| A2I68_RS04265 (A2I68_04145) | - | 804591..804818 (+) | 228 | WP_046099513.1 | DUF1514 family protein | - |
| A2I68_RS04270 (A2I68_04150) | - | 804834..805109 (+) | 276 | WP_046099512.1 | hypothetical protein | - |
| A2I68_RS04275 (A2I68_04155) | - | 805123..805518 (+) | 396 | WP_046099511.1 | phage protein | - |
| A2I68_RS04280 (A2I68_04160) | - | 805797..806111 (+) | 315 | WP_046099510.1 | HNH endonuclease | - |
| A2I68_RS04285 (A2I68_04165) | - | 806283..806645 (+) | 363 | WP_235318550.1 | hypothetical protein | - |
| A2I68_RS04290 (A2I68_04170) | - | 806642..808312 (+) | 1671 | WP_046099509.1 | terminase TerL endonuclease subunit | - |
| A2I68_RS04295 (A2I68_04175) | - | 808328..809506 (+) | 1179 | WP_046099508.1 | phage portal protein | - |
| A2I68_RS04300 (A2I68_04180) | - | 809469..810176 (+) | 708 | WP_046099507.1 | head maturation protease, ClpP-related | - |
| A2I68_RS04305 (A2I68_04185) | - | 810187..811380 (+) | 1194 | WP_046099506.1 | phage major capsid protein | - |
| A2I68_RS04310 (A2I68_04190) | - | 811395..811682 (+) | 288 | WP_046099505.1 | hypothetical protein | - |
| A2I68_RS04315 (A2I68_04195) | - | 811666..812034 (+) | 369 | WP_052719430.1 | hypothetical protein | - |
| A2I68_RS04320 (A2I68_04200) | - | 812024..812413 (+) | 390 | WP_046099504.1 | hypothetical protein | - |
| A2I68_RS04325 (A2I68_04205) | - | 812419..812820 (+) | 402 | WP_253719809.1 | hypothetical protein | - |
| A2I68_RS04330 (A2I68_04210) | - | 812840..813436 (+) | 597 | WP_046099502.1 | major tail protein | - |
| A2I68_RS04335 (A2I68_04215) | - | 813455..813652 (+) | 198 | WP_046099501.1 | hypothetical protein | - |
| A2I68_RS04340 (A2I68_04220) | - | 813722..814081 (+) | 360 | WP_046099500.1 | hypothetical protein | - |
| A2I68_RS04345 (A2I68_04225) | - | 814097..814618 (+) | 522 | WP_046099499.1 | hypothetical protein | - |
| A2I68_RS04350 (A2I68_04230) | - | 814760..819847 (+) | 5088 | WP_046099498.1 | phage tail tape measure protein | - |
| A2I68_RS04355 (A2I68_04235) | - | 819865..820722 (+) | 858 | WP_046099497.1 | phage tail domain-containing protein | - |
| A2I68_RS04360 (A2I68_04240) | - | 820731..822293 (+) | 1563 | WP_046099496.1 | prophage endopeptidase tail family protein | - |
| A2I68_RS04365 (A2I68_04245) | - | 822286..822816 (+) | 531 | WP_046099495.1 | hypothetical protein | - |
| A2I68_RS04370 (A2I68_04250) | - | 822834..825449 (+) | 2616 | WP_046099494.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| A2I68_RS04375 (A2I68_04255) | - | 825461..826942 (+) | 1482 | WP_052719429.1 | BppU family phage baseplate upper protein | - |
| A2I68_RS04380 (A2I68_04260) | - | 826956..827312 (+) | 357 | WP_046099493.1 | hypothetical protein | - |
| A2I68_RS04385 | - | 827296..827439 (+) | 144 | WP_082080547.1 | XkdX family protein | - |
| A2I68_RS04390 (A2I68_04265) | - | 827479..827787 (+) | 309 | WP_152648950.1 | hypothetical protein | - |
| A2I68_RS04395 (A2I68_04270) | - | 827840..828145 (+) | 306 | WP_046099491.1 | holin | - |
| A2I68_RS04400 (A2I68_04275) | - | 828145..829878 (+) | 1734 | WP_046099490.1 | peptidoglycan recognition family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16713.43 Da Isoelectric Point: 4.9115
>NTDB_id=180624 A2I68_RS04180 WP_046100579.1 797012..797458(+) (ssbA) [Staphylococcus carnosus strain TMW 2.1596]
MINRVVLVGRLTKDPEFRTTPSGIDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGLLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNTQSSNNNQSNNQVQQREKALQSDNPFNNSNNFDMDTDDLPF
MINRVVLVGRLTKDPEFRTTPSGIDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGLLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNTQSSNNNQSNNQVQQREKALQSDNPFNNSNNFDMDTDDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=180624 A2I68_RS04180 WP_046100579.1 797012..797458(+) (ssbA) [Staphylococcus carnosus strain TMW 2.1596]
ATGATTAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCAGAATTCAGAACAACGCCAAGCGGTATAGACGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAAAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGCGTCGTAT
TCCGTAAACAAGCAGAAAACGTCAATAACTATTTGAATAAAGGAAGTTTAGCAGGTGTCGATGGTCTCTTACAATCACGA
AGCTATGAGAATAAGGAAGGACAAAGAGTATTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TACACAATCCTCAAATAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGACAATCCATTCA
ATAATAGTAACAACTTTGATATGGATACGGATGATTTACCTTTTTAG
ATGATTAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCAGAATTCAGAACAACGCCAAGCGGTATAGACGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAAAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGCGTCGTAT
TCCGTAAACAAGCAGAAAACGTCAATAACTATTTGAATAAAGGAAGTTTAGCAGGTGTCGATGGTCTCTTACAATCACGA
AGCTATGAGAATAAGGAAGGACAAAGAGTATTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TACACAATCCTCAAATAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGACAATCCATTCA
ATAATAGTAACAACTTTGATATGGATACGGATGATTTACCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.662 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.588 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
71.622 |
0.419 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.865 |
100 |
0.399 |
| ssbA | Streptococcus mutans UA159 |
39.865 |
100 |
0.399 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.486 |
100 |
0.365 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.486 |
100 |
0.365 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.486 |
100 |
0.365 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.486 |
100 |
0.365 |