Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A7E59_RS08880 | Genome accession | NZ_CP015552 |
| Coordinates | 1817634..1818080 (-) | Length | 148 a.a. |
| NCBI ID | WP_046100579.1 | Uniprot ID | A0AAJ0JNB3 |
| Organism | Staphylococcus carnosus strain TMW 2.1538 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1785211..1828628 | 1817634..1818080 | within | 0 |
Gene organization within MGE regions
Location: 1785211..1828628
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7E59_RS08665 (A7E59_08515) | - | 1785211..1786944 (-) | 1734 | WP_046099490.1 | peptidoglycan recognition family protein | - |
| A7E59_RS08670 (A7E59_08520) | - | 1786944..1787249 (-) | 306 | WP_046099491.1 | holin | - |
| A7E59_RS08675 (A7E59_08525) | - | 1787302..1787610 (-) | 309 | WP_152648950.1 | hypothetical protein | - |
| A7E59_RS08680 | - | 1787650..1787793 (-) | 144 | WP_082080547.1 | XkdX family protein | - |
| A7E59_RS08685 (A7E59_08530) | - | 1787777..1788133 (-) | 357 | WP_046099493.1 | hypothetical protein | - |
| A7E59_RS08690 (A7E59_08535) | - | 1788147..1789628 (-) | 1482 | WP_052719429.1 | BppU family phage baseplate upper protein | - |
| A7E59_RS08695 (A7E59_08540) | - | 1789640..1792255 (-) | 2616 | WP_046099494.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| A7E59_RS08700 (A7E59_08545) | - | 1792273..1792803 (-) | 531 | WP_046099495.1 | hypothetical protein | - |
| A7E59_RS08705 (A7E59_08550) | - | 1792796..1794358 (-) | 1563 | WP_046099496.1 | prophage endopeptidase tail family protein | - |
| A7E59_RS08710 (A7E59_08555) | - | 1794367..1795224 (-) | 858 | WP_046099497.1 | phage tail domain-containing protein | - |
| A7E59_RS08715 (A7E59_08560) | - | 1795242..1800329 (-) | 5088 | WP_046099498.1 | phage tail tape measure protein | - |
| A7E59_RS08720 (A7E59_08565) | - | 1800471..1800992 (-) | 522 | WP_046099499.1 | hypothetical protein | - |
| A7E59_RS08725 (A7E59_08570) | - | 1801008..1801367 (-) | 360 | WP_046099500.1 | hypothetical protein | - |
| A7E59_RS08730 (A7E59_08575) | - | 1801437..1801634 (-) | 198 | WP_046099501.1 | hypothetical protein | - |
| A7E59_RS08735 (A7E59_08580) | - | 1801653..1802249 (-) | 597 | WP_046099502.1 | major tail protein | - |
| A7E59_RS08740 (A7E59_08585) | - | 1802249..1802656 (-) | 408 | WP_152648951.1 | hypothetical protein | - |
| A7E59_RS08745 (A7E59_08590) | - | 1802677..1803066 (-) | 390 | WP_046099504.1 | hypothetical protein | - |
| A7E59_RS08750 (A7E59_08595) | - | 1803056..1803424 (-) | 369 | WP_052719430.1 | hypothetical protein | - |
| A7E59_RS08755 (A7E59_08600) | - | 1803408..1803695 (-) | 288 | WP_046099505.1 | hypothetical protein | - |
| A7E59_RS08760 (A7E59_08605) | - | 1803710..1804903 (-) | 1194 | WP_046099506.1 | phage major capsid protein | - |
| A7E59_RS08765 (A7E59_08610) | - | 1804914..1805621 (-) | 708 | WP_046099507.1 | head maturation protease, ClpP-related | - |
| A7E59_RS08770 (A7E59_08615) | - | 1805584..1806762 (-) | 1179 | WP_046099508.1 | phage portal protein | - |
| A7E59_RS08775 (A7E59_08620) | - | 1806778..1808448 (-) | 1671 | WP_046099509.1 | terminase TerL endonuclease subunit | - |
| A7E59_RS08780 (A7E59_08625) | - | 1808445..1808807 (-) | 363 | WP_235318550.1 | hypothetical protein | - |
| A7E59_RS08785 (A7E59_08630) | - | 1808981..1809295 (-) | 315 | WP_046099510.1 | HNH endonuclease | - |
| A7E59_RS08790 (A7E59_08635) | - | 1809574..1809969 (-) | 396 | WP_046099511.1 | phage protein | - |
| A7E59_RS08795 (A7E59_08640) | - | 1809983..1810258 (-) | 276 | WP_046099512.1 | hypothetical protein | - |
| A7E59_RS08800 (A7E59_08645) | - | 1810274..1810501 (-) | 228 | WP_046099513.1 | DUF1514 family protein | - |
| A7E59_RS08805 | - | 1810501..1810635 (-) | 135 | WP_152648952.1 | transcriptional regulator | - |
| A7E59_RS08810 (A7E59_08650) | - | 1810632..1810823 (-) | 192 | WP_046099514.1 | hypothetical protein | - |
| A7E59_RS08815 | - | 1810826..1810987 (-) | 162 | WP_156768892.1 | hypothetical protein | - |
| A7E59_RS08820 (A7E59_08655) | - | 1810987..1811436 (-) | 450 | WP_046099515.1 | hypothetical protein | - |
| A7E59_RS08825 (A7E59_08660) | - | 1811623..1811940 (-) | 318 | WP_046099516.1 | hypothetical protein | - |
| A7E59_RS08830 (A7E59_08665) | - | 1812019..1812519 (-) | 501 | WP_046099517.1 | dUTP pyrophosphatase | - |
| A7E59_RS08835 | - | 1812578..1813330 (-) | 753 | WP_082080549.1 | nucleoside 2-deoxyribosyltransferase | - |
| A7E59_RS08840 (A7E59_08675) | - | 1813323..1813772 (-) | 450 | WP_052719496.1 | DUF3310 domain-containing protein | - |
| A7E59_RS08845 (A7E59_08680) | - | 1813773..1814303 (-) | 531 | WP_015899740.1 | hypothetical protein | - |
| A7E59_RS08850 | - | 1814309..1814485 (-) | 177 | WP_156768906.1 | hypothetical protein | - |
| A7E59_RS08855 (A7E59_08685) | - | 1814482..1814889 (-) | 408 | WP_046100673.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A7E59_RS08860 (A7E59_08695) | - | 1815055..1815840 (-) | 786 | WP_046100671.1 | ATP-binding protein | - |
| A7E59_RS08865 (A7E59_08700) | - | 1815841..1816611 (-) | 771 | WP_046100582.1 | conserved phage C-terminal domain-containing protein | - |
| A7E59_RS08870 (A7E59_08705) | - | 1816604..1816951 (-) | 348 | WP_200894321.1 | hypothetical protein | - |
| A7E59_RS08875 (A7E59_08710) | - | 1816944..1817621 (-) | 678 | WP_046100580.1 | putative HNHc nuclease | - |
| A7E59_RS08880 (A7E59_08715) | ssbA | 1817634..1818080 (-) | 447 | WP_046100579.1 | single-stranded DNA-binding protein | Machinery gene |
| A7E59_RS08885 (A7E59_08720) | - | 1818077..1818715 (-) | 639 | WP_046100578.1 | ERF family protein | - |
| A7E59_RS08890 (A7E59_08725) | - | 1818672..1818932 (-) | 261 | WP_015899731.1 | DUF2483 family protein | - |
| A7E59_RS08895 (A7E59_08730) | - | 1818925..1819170 (-) | 246 | WP_046100577.1 | hypothetical protein | - |
| A7E59_RS08900 (A7E59_08735) | - | 1819228..1819410 (-) | 183 | WP_046100576.1 | hypothetical protein | - |
| A7E59_RS08905 (A7E59_08740) | - | 1819407..1819637 (-) | 231 | WP_046100575.1 | DUF771 domain-containing protein | - |
| A7E59_RS08910 (A7E59_08745) | - | 1819697..1819903 (+) | 207 | WP_046100574.1 | hypothetical protein | - |
| A7E59_RS08915 (A7E59_08755) | - | 1820310..1820510 (-) | 201 | WP_046100573.1 | hypothetical protein | - |
| A7E59_RS08920 (A7E59_08760) | - | 1820522..1820731 (-) | 210 | WP_046100572.1 | hypothetical protein | - |
| A7E59_RS08925 (A7E59_08765) | - | 1820765..1821205 (-) | 441 | WP_052719490.1 | ORF6C domain-containing protein | - |
| A7E59_RS08930 (A7E59_08770) | - | 1821314..1822255 (-) | 942 | WP_046100570.1 | DUF3102 domain-containing protein | - |
| A7E59_RS08935 (A7E59_08775) | - | 1822269..1822523 (-) | 255 | WP_046100569.1 | helix-turn-helix transcriptional regulator | - |
| A7E59_RS08940 (A7E59_08780) | - | 1822716..1823354 (+) | 639 | WP_046100568.1 | XRE family transcriptional regulator | - |
| A7E59_RS08945 (A7E59_08785) | - | 1823408..1824088 (+) | 681 | WP_046100567.1 | VanZ family protein | - |
| A7E59_RS08950 (A7E59_08790) | - | 1824146..1825174 (+) | 1029 | WP_046100566.1 | tyrosine-type recombinase/integrase | - |
| A7E59_RS08955 (A7E59_08795) | - | 1825490..1825843 (-) | 354 | WP_052719489.1 | HIRAN domain-containing protein | - |
| A7E59_RS08960 (A7E59_08800) | - | 1825828..1826430 (-) | 603 | WP_052719488.1 | hypothetical protein | - |
| A7E59_RS08965 (A7E59_08805) | - | 1826478..1826951 (-) | 474 | WP_052719487.1 | hypothetical protein | - |
| A7E59_RS08970 | - | 1826968..1827468 (-) | 501 | WP_235318616.1 | hypothetical protein | - |
| A7E59_RS08975 (A7E59_08815) | - | 1828056..1828628 (-) | 573 | WP_052719486.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16713.43 Da Isoelectric Point: 4.9115
>NTDB_id=180611 A7E59_RS08880 WP_046100579.1 1817634..1818080(-) (ssbA) [Staphylococcus carnosus strain TMW 2.1538]
MINRVVLVGRLTKDPEFRTTPSGIDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGLLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNTQSSNNNQSNNQVQQREKALQSDNPFNNSNNFDMDTDDLPF
MINRVVLVGRLTKDPEFRTTPSGIDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGLLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNTQSSNNNQSNNQVQQREKALQSDNPFNNSNNFDMDTDDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=180611 A7E59_RS08880 WP_046100579.1 1817634..1818080(-) (ssbA) [Staphylococcus carnosus strain TMW 2.1538]
ATGATTAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCAGAATTCAGAACAACGCCAAGCGGTATAGACGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAAAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGCGTCGTAT
TCCGTAAACAAGCAGAAAACGTCAATAACTATTTGAATAAAGGAAGTTTAGCAGGTGTCGATGGTCTCTTACAATCACGA
AGCTATGAGAATAAGGAAGGACAAAGAGTATTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TACACAATCCTCAAATAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGACAATCCATTCA
ATAATAGTAACAACTTTGATATGGATACGGATGATTTACCTTTTTAG
ATGATTAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCAGAATTCAGAACAACGCCAAGCGGTATAGACGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAAAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGCGTCGTAT
TCCGTAAACAAGCAGAAAACGTCAATAACTATTTGAATAAAGGAAGTTTAGCAGGTGTCGATGGTCTCTTACAATCACGA
AGCTATGAGAATAAGGAAGGACAAAGAGTATTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TACACAATCCTCAAATAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGACAATCCATTCA
ATAATAGTAACAACTTTGATATGGATACGGATGATTTACCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.662 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.588 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
71.622 |
0.419 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.865 |
100 |
0.399 |
| ssbA | Streptococcus mutans UA159 |
39.865 |
100 |
0.399 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.486 |
100 |
0.365 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.486 |
100 |
0.365 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.486 |
100 |
0.365 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.486 |
100 |
0.365 |