Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A2I64_RS10190 | Genome accession | NZ_CP015537 |
| Coordinates | 2084508..2084939 (-) | Length | 143 a.a. |
| NCBI ID | WP_015899733.1 | Uniprot ID | B9DJE5 |
| Organism | Staphylococcus carnosus strain TMW 2.269 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2047284..2093516 | 2084508..2084939 | within | 0 |
Gene organization within MGE regions
Location: 2047284..2093516
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A2I64_RS09940 (A2I64_09785) | - | 2047284..2048084 (-) | 801 | WP_015899779.1 | glycerophosphodiester phosphodiesterase family protein | - |
| A2I64_RS09945 | - | 2048164..2048304 (-) | 141 | WP_015899778.1 | hypothetical protein | - |
| A2I64_RS09950 (A2I64_09790) | - | 2048297..2048977 (-) | 681 | WP_015899777.1 | hypothetical protein | - |
| A2I64_RS09955 (A2I64_09800) | - | 2049671..2051074 (-) | 1404 | WP_015899776.1 | N-acetylmuramoyl-L-alanine amidase | - |
| A2I64_RS09960 (A2I64_09805) | - | 2051074..2051337 (-) | 264 | WP_015899775.1 | phage holin | - |
| A2I64_RS09965 (A2I64_09810) | - | 2051396..2053501 (-) | 2106 | WP_253718818.1 | BppU family phage baseplate upper protein | - |
| A2I64_RS09970 (A2I64_09815) | - | 2053548..2053946 (-) | 399 | WP_015899773.1 | hypothetical protein | - |
| A2I64_RS09975 (A2I64_09820) | - | 2053933..2054367 (-) | 435 | WP_235851280.1 | hypothetical protein | - |
| A2I64_RS09980 | - | 2054394..2054567 (-) | 174 | WP_015899771.1 | XkdX family protein | - |
| A2I64_RS09985 (A2I64_09825) | - | 2054567..2054923 (-) | 357 | WP_015899770.1 | hypothetical protein | - |
| A2I64_RS09990 (A2I64_09830) | - | 2054928..2056352 (-) | 1425 | WP_015899769.1 | BppU family phage baseplate upper protein | - |
| A2I64_RS09995 (A2I64_09835) | - | 2056355..2058310 (-) | 1956 | WP_015899768.1 | glycosyl hydrolase family 28-related protein | - |
| A2I64_RS10000 (A2I64_09840) | - | 2058315..2058533 (-) | 219 | WP_015899767.1 | hypothetical protein | - |
| A2I64_RS10005 (A2I64_09845) | - | 2058526..2060091 (-) | 1566 | WP_015899766.1 | prophage endopeptidase tail family protein | - |
| A2I64_RS10010 (A2I64_09850) | - | 2060102..2060935 (-) | 834 | WP_015899765.1 | phage tail domain-containing protein | - |
| A2I64_RS12715 (A2I64_09855) | - | 2060932..2065140 (-) | 4209 | WP_301283109.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| A2I64_RS10020 | - | 2065088..2067193 (-) | 2106 | WP_015899763.1 | phage tail tape measure protein | - |
| A2I64_RS10025 | - | 2067207..2067362 (-) | 156 | WP_015899762.1 | hypothetical protein | - |
| A2I64_RS10030 (A2I64_09860) | - | 2067413..2067757 (-) | 345 | WP_015899761.1 | hypothetical protein | - |
| A2I64_RS10035 (A2I64_09865) | - | 2067805..2068266 (-) | 462 | WP_015899760.1 | Ig-like domain-containing protein | - |
| A2I64_RS10040 (A2I64_09870) | - | 2068343..2068984 (-) | 642 | WP_015899759.1 | major tail protein | - |
| A2I64_RS10045 (A2I64_09875) | - | 2069026..2069421 (-) | 396 | WP_015899758.1 | hypothetical protein | - |
| A2I64_RS10050 (A2I64_09880) | - | 2069418..2069825 (-) | 408 | WP_015899757.1 | hypothetical protein | - |
| A2I64_RS10055 (A2I64_09885) | - | 2069822..2070178 (-) | 357 | WP_231839067.1 | hypothetical protein | - |
| A2I64_RS10060 (A2I64_09890) | - | 2070162..2070458 (-) | 297 | WP_015899755.1 | hypothetical protein | - |
| A2I64_RS10065 (A2I64_09895) | - | 2070531..2071649 (-) | 1119 | WP_015899754.1 | phage major capsid protein | - |
| A2I64_RS10070 (A2I64_09900) | - | 2071674..2072390 (-) | 717 | WP_015899753.1 | head maturation protease, ClpP-related | - |
| A2I64_RS10075 (A2I64_09905) | - | 2072380..2073552 (-) | 1173 | WP_015899752.1 | phage portal protein | - |
| A2I64_RS10080 (A2I64_09910) | - | 2073567..2075207 (-) | 1641 | WP_015899751.1 | terminase large subunit | - |
| A2I64_RS10085 (A2I64_09915) | - | 2075204..2075551 (-) | 348 | WP_015899750.1 | hypothetical protein | - |
| A2I64_RS10090 (A2I64_09920) | - | 2075728..2076060 (-) | 333 | WP_041612952.1 | HNH endonuclease | - |
| A2I64_RS10095 (A2I64_09925) | - | 2076355..2076768 (-) | 414 | WP_015899749.1 | hypothetical protein | - |
| A2I64_RS10100 (A2I64_09930) | - | 2076781..2076960 (-) | 180 | WP_015899748.1 | hypothetical protein | - |
| A2I64_RS10105 | - | 2077094..2077468 (-) | 375 | WP_253718819.1 | transcriptional activator RinB | - |
| A2I64_RS10110 (A2I64_09940) | - | 2077484..2077768 (-) | 285 | WP_015899747.1 | hypothetical protein | - |
| A2I64_RS10115 (A2I64_09945) | - | 2077761..2078033 (-) | 273 | WP_041612950.1 | hypothetical protein | - |
| A2I64_RS10120 | - | 2078175..2078282 (-) | 108 | Protein_1968 | DUF1381 domain-containing protein | - |
| A2I64_RS10125 (A2I64_09955) | - | 2078283..2078489 (-) | 207 | WP_015899745.1 | hypothetical protein | - |
| A2I64_RS10130 (A2I64_09960) | - | 2078539..2079048 (-) | 510 | WP_015899744.1 | dUTP pyrophosphatase | - |
| A2I64_RS10135 (A2I64_09965) | - | 2079049..2079252 (-) | 204 | WP_041612949.1 | hypothetical protein | - |
| A2I64_RS10140 (A2I64_09970) | - | 2079245..2079442 (-) | 198 | WP_015899743.1 | hypothetical protein | - |
| A2I64_RS10145 (A2I64_09975) | - | 2079489..2079974 (-) | 486 | WP_015899742.1 | nucleoside 2-deoxyribosyltransferase | - |
| A2I64_RS10150 (A2I64_09980) | - | 2079967..2080443 (-) | 477 | WP_015899741.1 | DUF3310 domain-containing protein | - |
| A2I64_RS10155 (A2I64_09985) | - | 2080444..2080974 (-) | 531 | WP_015899740.1 | hypothetical protein | - |
| A2I64_RS10160 | - | 2080980..2081144 (-) | 165 | WP_253718820.1 | hypothetical protein | - |
| A2I64_RS10165 (A2I64_09990) | - | 2081153..2081560 (-) | 408 | WP_015899738.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A2I64_RS10170 (A2I64_10000) | - | 2081726..2082511 (-) | 786 | WP_015899737.1 | ATP-binding protein | - |
| A2I64_RS10175 (A2I64_10005) | - | 2082512..2083273 (-) | 762 | WP_015899736.1 | conserved phage C-terminal domain-containing protein | - |
| A2I64_RS10180 (A2I64_10010) | - | 2083270..2083944 (-) | 675 | WP_015899735.1 | putative HNHc nuclease | - |
| A2I64_RS10185 (A2I64_10015) | - | 2083945..2084496 (-) | 552 | WP_015899734.1 | NUMOD4 domain-containing protein | - |
| A2I64_RS10190 (A2I64_10020) | ssbA | 2084508..2084939 (-) | 432 | WP_015899733.1 | single-stranded DNA-binding protein | Machinery gene |
| A2I64_RS10195 (A2I64_10025) | - | 2084939..2085610 (-) | 672 | WP_015899732.1 | ERF family protein | - |
| A2I64_RS10200 (A2I64_10030) | - | 2085567..2085827 (-) | 261 | WP_015899731.1 | DUF2483 family protein | - |
| A2I64_RS10205 (A2I64_10035) | - | 2085820..2086065 (-) | 246 | WP_015899730.1 | hypothetical protein | - |
| A2I64_RS10210 (A2I64_10040) | - | 2086153..2086374 (-) | 222 | WP_041612947.1 | hypothetical protein | - |
| A2I64_RS10215 (A2I64_10045) | - | 2086371..2086607 (-) | 237 | WP_015899729.1 | hypothetical protein | - |
| A2I64_RS10220 (A2I64_10050) | - | 2086671..2086943 (+) | 273 | WP_015899728.1 | hypothetical protein | - |
| A2I64_RS10225 | - | 2086921..2087070 (-) | 150 | WP_167313206.1 | hypothetical protein | - |
| A2I64_RS10230 (A2I64_10060) | - | 2087614..2087838 (+) | 225 | WP_015899727.1 | hypothetical protein | - |
| A2I64_RS10235 | - | 2087831..2087977 (-) | 147 | WP_165380129.1 | hypothetical protein | - |
| A2I64_RS10240 (A2I64_10065) | - | 2087992..2088759 (-) | 768 | WP_015899725.1 | phage antirepressor | - |
| A2I64_RS10245 (A2I64_10070) | - | 2088796..2089023 (-) | 228 | WP_050731401.1 | helix-turn-helix transcriptional regulator | - |
| A2I64_RS10250 (A2I64_10075) | - | 2089198..2089521 (+) | 324 | WP_015899724.1 | helix-turn-helix transcriptional regulator | - |
| A2I64_RS10255 (A2I64_10080) | - | 2089537..2090001 (+) | 465 | WP_015899723.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A2I64_RS10260 (A2I64_10085) | - | 2090343..2090525 (+) | 183 | WP_015899722.1 | hypothetical protein | - |
| A2I64_RS10265 (A2I64_10090) | - | 2091002..2092051 (+) | 1050 | WP_015899721.1 | tyrosine-type recombinase/integrase | - |
| A2I64_RS10270 (A2I64_10095) | sufB | 2092119..2093516 (-) | 1398 | WP_015899720.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 15877.49 Da Isoelectric Point: 5.2069
>NTDB_id=180576 A2I64_RS10190 WP_015899733.1 2084508..2084939(-) (ssbA) [Staphylococcus carnosus strain TMW 2.269]
MINRVVLVGRLTKDPEFRTTPSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGRLQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNNQQNNQPQQQQGQAPAGNNPFGNASDDISESELPF
MINRVVLVGRLTKDPEFRTTPSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGRLQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNNQQNNQPQQQQGQAPAGNNPFGNASDDISESELPF
Nucleotide
Download Length: 432 bp
>NTDB_id=180576 A2I64_RS10190 WP_015899733.1 2084508..2084939(-) (ssbA) [Staphylococcus carnosus strain TMW 2.269]
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACAAAAGATCCAGAATTCAGAACAACCCCGAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTGTCGATGGTCGCTTACAATCACGC
AGCTATGAAAATAAGGAAGGACAACGTGTGTTTGTAACCGAAGTAGTAGCAGATAGTGTTCAATTCTTAGAGCCAAAGAA
TAACAATCAACAAAACAATCAACCTCAACAACAACAAGGGCAAGCACCAGCAGGCAATAACCCGTTTGGAAATGCTAGCG
ACGATATTTCAGAATCGGAACTCCCTTTCTAG
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACAAAAGATCCAGAATTCAGAACAACCCCGAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTGTCGATGGTCGCTTACAATCACGC
AGCTATGAAAATAAGGAAGGACAACGTGTGTTTGTAACCGAAGTAGTAGCAGATAGTGTTCAATTCTTAGAGCCAAAGAA
TAACAATCAACAAAACAATCAACCTCAACAACAACAAGGGCAAGCACCAGCAGGCAATAACCCGTTTGGAAATGCTAGCG
ACGATATTTCAGAATCGGAACTCCCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.685 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.622 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
74.126 |
0.448 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.75 |
100 |
0.441 |
| ssbA | Streptococcus mutans UA159 |
43.056 |
100 |
0.434 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.259 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.259 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.559 |
100 |
0.406 |