Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A2I62_RS10180 | Genome accession | NZ_CP015531 |
| Coordinates | 2084492..2084923 (-) | Length | 143 a.a. |
| NCBI ID | WP_015899733.1 | Uniprot ID | B9DJE5 |
| Organism | Staphylococcus carnosus strain TMW 2.146 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2047268..2093500 | 2084492..2084923 | within | 0 |
Gene organization within MGE regions
Location: 2047268..2093500
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A2I62_RS09930 (A2I62_09790) | - | 2047268..2048068 (-) | 801 | WP_015899779.1 | glycerophosphodiester phosphodiesterase family protein | - |
| A2I62_RS09935 | - | 2048148..2048288 (-) | 141 | WP_015899778.1 | hypothetical protein | - |
| A2I62_RS09940 (A2I62_09795) | - | 2048281..2048961 (-) | 681 | WP_015899777.1 | hypothetical protein | - |
| A2I62_RS09945 (A2I62_09805) | - | 2049655..2051058 (-) | 1404 | WP_015899776.1 | N-acetylmuramoyl-L-alanine amidase | - |
| A2I62_RS09950 (A2I62_09810) | - | 2051058..2051321 (-) | 264 | WP_015899775.1 | phage holin | - |
| A2I62_RS09955 (A2I62_09815) | - | 2051380..2053485 (-) | 2106 | WP_015899774.1 | BppU family phage baseplate upper protein | - |
| A2I62_RS09960 (A2I62_09820) | - | 2053532..2053930 (-) | 399 | WP_015899773.1 | hypothetical protein | - |
| A2I62_RS09965 (A2I62_09825) | - | 2053917..2054339 (-) | 423 | WP_015899772.1 | hypothetical protein | - |
| A2I62_RS09970 | - | 2054378..2054551 (-) | 174 | WP_015899771.1 | XkdX family protein | - |
| A2I62_RS09975 (A2I62_09830) | - | 2054551..2054907 (-) | 357 | WP_015899770.1 | hypothetical protein | - |
| A2I62_RS09980 (A2I62_09835) | - | 2054912..2056336 (-) | 1425 | WP_015899769.1 | BppU family phage baseplate upper protein | - |
| A2I62_RS09985 (A2I62_09840) | - | 2056339..2058294 (-) | 1956 | WP_015899768.1 | glycosyl hydrolase family 28-related protein | - |
| A2I62_RS09990 (A2I62_09845) | - | 2058299..2058517 (-) | 219 | WP_015899767.1 | hypothetical protein | - |
| A2I62_RS09995 (A2I62_09850) | - | 2058510..2060075 (-) | 1566 | WP_015899766.1 | prophage endopeptidase tail family protein | - |
| A2I62_RS10000 (A2I62_09855) | - | 2060086..2060919 (-) | 834 | WP_015899765.1 | phage tail domain-containing protein | - |
| A2I62_RS12705 (A2I62_09860) | - | 2060916..2065124 (-) | 4209 | WP_301283109.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| A2I62_RS10010 | - | 2065072..2067177 (-) | 2106 | WP_015899763.1 | phage tail tape measure protein | - |
| A2I62_RS10015 | - | 2067191..2067346 (-) | 156 | WP_015899762.1 | hypothetical protein | - |
| A2I62_RS10020 (A2I62_09865) | - | 2067397..2067741 (-) | 345 | WP_015899761.1 | hypothetical protein | - |
| A2I62_RS10025 (A2I62_09870) | - | 2067789..2068250 (-) | 462 | WP_015899760.1 | Ig-like domain-containing protein | - |
| A2I62_RS10030 (A2I62_09875) | - | 2068327..2068968 (-) | 642 | WP_015899759.1 | major tail protein | - |
| A2I62_RS10035 (A2I62_09880) | - | 2069010..2069405 (-) | 396 | WP_015899758.1 | hypothetical protein | - |
| A2I62_RS10040 (A2I62_09885) | - | 2069402..2069809 (-) | 408 | WP_015899757.1 | hypothetical protein | - |
| A2I62_RS10045 (A2I62_09890) | - | 2069806..2070162 (-) | 357 | WP_231839067.1 | hypothetical protein | - |
| A2I62_RS10050 (A2I62_09895) | - | 2070146..2070442 (-) | 297 | WP_015899755.1 | hypothetical protein | - |
| A2I62_RS10055 (A2I62_09900) | - | 2070515..2071633 (-) | 1119 | WP_015899754.1 | phage major capsid protein | - |
| A2I62_RS10060 (A2I62_09905) | - | 2071658..2072374 (-) | 717 | WP_015899753.1 | head maturation protease, ClpP-related | - |
| A2I62_RS10065 (A2I62_09910) | - | 2072364..2073536 (-) | 1173 | WP_015899752.1 | phage portal protein | - |
| A2I62_RS10070 (A2I62_09915) | - | 2073551..2075191 (-) | 1641 | WP_015899751.1 | terminase large subunit | - |
| A2I62_RS10075 (A2I62_09920) | - | 2075188..2075535 (-) | 348 | WP_015899750.1 | hypothetical protein | - |
| A2I62_RS10080 (A2I62_09925) | - | 2075712..2076044 (-) | 333 | WP_041612952.1 | HNH endonuclease | - |
| A2I62_RS10085 (A2I62_09930) | - | 2076339..2076752 (-) | 414 | WP_015899749.1 | hypothetical protein | - |
| A2I62_RS10090 (A2I62_09935) | - | 2076765..2076944 (-) | 180 | WP_015899748.1 | hypothetical protein | - |
| A2I62_RS10095 | - | 2077078..2077464 (-) | 387 | WP_041612951.1 | hypothetical protein | - |
| A2I62_RS10100 (A2I62_09945) | - | 2077468..2077752 (-) | 285 | WP_015899747.1 | hypothetical protein | - |
| A2I62_RS10105 (A2I62_09950) | - | 2077745..2078017 (-) | 273 | WP_041612950.1 | hypothetical protein | - |
| A2I62_RS10110 | - | 2078159..2078266 (-) | 108 | Protein_1967 | DUF1381 domain-containing protein | - |
| A2I62_RS10115 (A2I62_09960) | - | 2078267..2078473 (-) | 207 | WP_015899745.1 | hypothetical protein | - |
| A2I62_RS10120 (A2I62_09965) | - | 2078523..2079032 (-) | 510 | WP_015899744.1 | dUTP pyrophosphatase | - |
| A2I62_RS10125 (A2I62_09970) | - | 2079033..2079236 (-) | 204 | WP_041612949.1 | hypothetical protein | - |
| A2I62_RS10130 (A2I62_09975) | - | 2079229..2079426 (-) | 198 | WP_015899743.1 | hypothetical protein | - |
| A2I62_RS10135 (A2I62_09980) | - | 2079473..2079958 (-) | 486 | WP_015899742.1 | nucleoside 2-deoxyribosyltransferase | - |
| A2I62_RS10140 (A2I62_09985) | - | 2079951..2080427 (-) | 477 | WP_015899741.1 | DUF3310 domain-containing protein | - |
| A2I62_RS10145 (A2I62_09990) | - | 2080428..2080958 (-) | 531 | WP_015899740.1 | hypothetical protein | - |
| A2I62_RS10150 | - | 2080964..2081140 (-) | 177 | WP_015899739.1 | hypothetical protein | - |
| A2I62_RS10155 (A2I62_09995) | - | 2081137..2081544 (-) | 408 | WP_015899738.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A2I62_RS10160 (A2I62_10005) | - | 2081710..2082495 (-) | 786 | WP_015899737.1 | ATP-binding protein | - |
| A2I62_RS10165 (A2I62_10010) | - | 2082496..2083257 (-) | 762 | WP_015899736.1 | conserved phage C-terminal domain-containing protein | - |
| A2I62_RS10170 (A2I62_10015) | - | 2083254..2083928 (-) | 675 | WP_015899735.1 | putative HNHc nuclease | - |
| A2I62_RS10175 (A2I62_10020) | - | 2083929..2084480 (-) | 552 | WP_015899734.1 | NUMOD4 domain-containing protein | - |
| A2I62_RS10180 (A2I62_10025) | ssbA | 2084492..2084923 (-) | 432 | WP_015899733.1 | single-stranded DNA-binding protein | Machinery gene |
| A2I62_RS10185 (A2I62_10030) | - | 2084923..2085594 (-) | 672 | WP_015899732.1 | ERF family protein | - |
| A2I62_RS10190 (A2I62_10035) | - | 2085551..2085811 (-) | 261 | WP_015899731.1 | DUF2483 family protein | - |
| A2I62_RS10195 (A2I62_10040) | - | 2085804..2086049 (-) | 246 | WP_015899730.1 | hypothetical protein | - |
| A2I62_RS10200 (A2I62_10045) | - | 2086137..2086358 (-) | 222 | WP_041612947.1 | hypothetical protein | - |
| A2I62_RS10205 (A2I62_10050) | - | 2086355..2086591 (-) | 237 | WP_015899729.1 | hypothetical protein | - |
| A2I62_RS10210 (A2I62_10055) | - | 2086655..2086927 (+) | 273 | WP_015899728.1 | hypothetical protein | - |
| A2I62_RS10215 | - | 2086905..2087054 (-) | 150 | WP_167313206.1 | hypothetical protein | - |
| A2I62_RS10220 (A2I62_10065) | - | 2087598..2087822 (+) | 225 | WP_015899727.1 | hypothetical protein | - |
| A2I62_RS10225 | - | 2087815..2087961 (-) | 147 | WP_165380129.1 | hypothetical protein | - |
| A2I62_RS10230 (A2I62_10070) | - | 2087976..2088743 (-) | 768 | WP_015899725.1 | phage antirepressor | - |
| A2I62_RS10235 (A2I62_10075) | - | 2088780..2089007 (-) | 228 | WP_050731401.1 | helix-turn-helix transcriptional regulator | - |
| A2I62_RS10240 (A2I62_10080) | - | 2089182..2089505 (+) | 324 | WP_015899724.1 | helix-turn-helix transcriptional regulator | - |
| A2I62_RS10245 (A2I62_10085) | - | 2089521..2089985 (+) | 465 | WP_015899723.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A2I62_RS10250 (A2I62_10090) | - | 2090327..2090509 (+) | 183 | WP_015899722.1 | hypothetical protein | - |
| A2I62_RS10255 (A2I62_10095) | - | 2090986..2092035 (+) | 1050 | WP_015899721.1 | tyrosine-type recombinase/integrase | - |
| A2I62_RS10260 (A2I62_10100) | sufB | 2092103..2093500 (-) | 1398 | WP_015899720.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 15877.49 Da Isoelectric Point: 5.2069
>NTDB_id=180411 A2I62_RS10180 WP_015899733.1 2084492..2084923(-) (ssbA) [Staphylococcus carnosus strain TMW 2.146]
MINRVVLVGRLTKDPEFRTTPSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGRLQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNNQQNNQPQQQQGQAPAGNNPFGNASDDISESELPF
MINRVVLVGRLTKDPEFRTTPSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGRLQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNNQQNNQPQQQQGQAPAGNNPFGNASDDISESELPF
Nucleotide
Download Length: 432 bp
>NTDB_id=180411 A2I62_RS10180 WP_015899733.1 2084492..2084923(-) (ssbA) [Staphylococcus carnosus strain TMW 2.146]
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACAAAAGATCCAGAATTCAGAACAACCCCGAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTGTCGATGGTCGCTTACAATCACGC
AGCTATGAAAATAAGGAAGGACAACGTGTGTTTGTAACCGAAGTAGTAGCAGATAGTGTTCAATTCTTAGAGCCAAAGAA
TAACAATCAACAAAACAATCAACCTCAACAACAACAAGGGCAAGCACCAGCAGGCAATAACCCGTTTGGAAATGCTAGCG
ACGATATTTCAGAATCGGAACTCCCTTTCTAG
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACAAAAGATCCAGAATTCAGAACAACCCCGAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTGTCGATGGTCGCTTACAATCACGC
AGCTATGAAAATAAGGAAGGACAACGTGTGTTTGTAACCGAAGTAGTAGCAGATAGTGTTCAATTCTTAGAGCCAAAGAA
TAACAATCAACAAAACAATCAACCTCAACAACAACAAGGGCAAGCACCAGCAGGCAATAACCCGTTTGGAAATGCTAGCG
ACGATATTTCAGAATCGGAACTCCCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.685 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.622 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
74.126 |
0.448 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.75 |
100 |
0.441 |
| ssbA | Streptococcus mutans UA159 |
43.056 |
100 |
0.434 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.259 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.259 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.559 |
100 |
0.406 |