Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A6V38_RS11285 | Genome accession | NZ_CP015447 |
| Coordinates | 2142402..2142830 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain M92 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2107167..2166875 | 2142402..2142830 | within | 0 |
Gene organization within MGE regions
Location: 2107167..2166875
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6V38_RS10995 (A6V38_10980) | scn | 2107167..2107517 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| A6V38_RS11005 (A6V38_10990) | - | 2107689..2108861 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| A6V38_RS11010 (A6V38_10995) | - | 2109360..2109698 (-) | 339 | Protein_2033 | SH3 domain-containing protein | - |
| A6V38_RS11030 (A6V38_11015) | sak | 2110346..2110837 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| A6V38_RS11035 (A6V38_11020) | - | 2111028..2111783 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| A6V38_RS11040 (A6V38_11025) | - | 2111795..2112049 (-) | 255 | WP_000611512.1 | phage holin | - |
| A6V38_RS11045 (A6V38_11030) | - | 2112101..2112208 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| A6V38_RS11050 (A6V38_11035) | pepG1 | 2112261..2112395 (-) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| A6V38_RS11055 (A6V38_11040) | - | 2112580..2112954 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| A6V38_RS11060 (A6V38_11045) | - | 2113010..2113297 (-) | 288 | WP_001262620.1 | hypothetical protein | - |
| A6V38_RS11065 (A6V38_11050) | - | 2113343..2113495 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| A6V38_RS11070 (A6V38_11055) | - | 2113488..2117270 (-) | 3783 | WP_000582132.1 | phage tail spike protein | - |
| A6V38_RS11075 (A6V38_11060) | - | 2117286..2118776 (-) | 1491 | WP_001154317.1 | phage distal tail protein | - |
| A6V38_RS11080 (A6V38_11065) | - | 2118776..2123425 (-) | 4650 | WP_031906215.1 | phage tail tape measure protein | - |
| A6V38_RS11085 (A6V38_11070) | gpGT | 2123481..2123603 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| A6V38_RS11090 (A6V38_11075) | gpG | 2123663..2124109 (-) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| A6V38_RS11095 (A6V38_11080) | - | 2124174..2125127 (-) | 954 | WP_000570652.1 | major tail protein | - |
| A6V38_RS11100 (A6V38_11085) | - | 2125128..2125508 (-) | 381 | WP_000611449.1 | hypothetical protein | - |
| A6V38_RS11105 (A6V38_11090) | - | 2125505..2125882 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| A6V38_RS11110 (A6V38_11095) | - | 2125882..2126217 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| A6V38_RS11115 (A6V38_11100) | - | 2126204..2126536 (-) | 333 | WP_031906214.1 | head-tail connector protein | - |
| A6V38_RS11120 (A6V38_11105) | - | 2126545..2126703 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| A6V38_RS11125 (A6V38_11110) | - | 2126739..2127986 (-) | 1248 | WP_000849957.1 | phage major capsid protein | - |
| A6V38_RS11130 (A6V38_11115) | - | 2128074..2128658 (-) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| A6V38_RS11135 (A6V38_11120) | - | 2128651..2129901 (-) | 1251 | WP_000511064.1 | phage portal protein | - |
| A6V38_RS11140 (A6V38_11125) | - | 2129907..2130107 (-) | 201 | WP_000365301.1 | hypothetical protein | - |
| A6V38_RS11145 (A6V38_11130) | - | 2130121..2131815 (-) | 1695 | WP_000133304.1 | terminase large subunit | - |
| A6V38_RS11150 (A6V38_11135) | - | 2131818..2132285 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| A6V38_RS11155 (A6V38_11140) | - | 2132413..2132757 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| A6V38_RS11160 (A6V38_11145) | - | 2132773..2133225 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| A6V38_RS11165 (A6V38_11150) | - | 2133340..2133810 (-) | 471 | WP_000282755.1 | hypothetical protein | - |
| A6V38_RS11175 (A6V38_11160) | - | 2133833..2134033 (-) | 201 | WP_084939536.1 | DUF1514 family protein | - |
| A6V38_RS11180 (A6V38_11165) | rinB | 2134033..2134182 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| A6V38_RS11185 (A6V38_11170) | - | 2134182..2134568 (-) | 387 | WP_001570808.1 | hypothetical protein | - |
| A6V38_RS11190 (A6V38_11175) | - | 2134558..2134776 (-) | 219 | WP_000671662.1 | hypothetical protein | - |
| A6V38_RS11195 (A6V38_11180) | - | 2134787..2134990 (-) | 204 | WP_000219344.1 | hypothetical protein | - |
| A6V38_RS11200 (A6V38_11185) | - | 2134987..2135193 (-) | 207 | WP_000195768.1 | DUF1381 domain-containing protein | - |
| A6V38_RS11205 (A6V38_11190) | - | 2135230..2135766 (-) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| A6V38_RS11210 (A6V38_11195) | - | 2135759..2136007 (-) | 249 | WP_031895328.1 | DUF1024 family protein | - |
| A6V38_RS11215 (A6V38_11200) | - | 2136000..2136308 (-) | 309 | WP_000144710.1 | hypothetical protein | - |
| A6V38_RS11220 (A6V38_11205) | - | 2136305..2136652 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| A6V38_RS11225 (A6V38_11210) | - | 2136649..2137050 (-) | 402 | WP_000695759.1 | hypothetical protein | - |
| A6V38_RS11230 (A6V38_11215) | - | 2137053..2137259 (-) | 207 | WP_000693987.1 | hypothetical protein | - |
| A6V38_RS11235 (A6V38_11220) | - | 2137273..2137521 (-) | 249 | WP_078150933.1 | SAV1978 family virulence-associated passenger protein | - |
| A6V38_RS11240 (A6V38_11225) | - | 2137521..2137775 (-) | 255 | WP_000022735.1 | DUF3310 domain-containing protein | - |
| A6V38_RS11245 (A6V38_11230) | - | 2137775..2138135 (-) | 361 | Protein_2076 | SA1788 family PVL leukocidin-associated protein | - |
| A6V38_RS11250 (A6V38_11235) | - | 2138136..2138321 (-) | 186 | WP_001187264.1 | DUF3113 family protein | - |
| A6V38_RS11255 (A6V38_11240) | - | 2138321..2138728 (-) | 408 | WP_000401950.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A6V38_RS11260 (A6V38_11245) | - | 2138738..2138959 (-) | 222 | WP_001123684.1 | DUF3269 family protein | - |
| A6V38_RS16160 | - | 2138972..2139133 (-) | 162 | WP_000237154.1 | hypothetical protein | - |
| A6V38_RS11265 (A6V38_11255) | - | 2139127..2139906 (-) | 780 | WP_053012518.1 | ATP-binding protein | - |
| A6V38_RS11270 (A6V38_11260) | - | 2139916..2140686 (-) | 771 | WP_031783365.1 | conserved phage C-terminal domain-containing protein | - |
| A6V38_RS11275 (A6V38_11265) | - | 2140751..2141608 (+) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| A6V38_RS11280 (A6V38_11270) | - | 2141714..2142388 (-) | 675 | WP_084939537.1 | putative HNHc nuclease | - |
| A6V38_RS11285 (A6V38_11275) | ssbA | 2142402..2142830 (-) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| A6V38_RS11290 (A6V38_11280) | - | 2142830..2143453 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| A6V38_RS11295 (A6V38_11285) | - | 2143446..2143667 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| A6V38_RS11300 (A6V38_11290) | - | 2143677..2143937 (-) | 261 | WP_015977954.1 | DUF1108 family protein | - |
| A6V38_RS11305 (A6V38_11295) | - | 2144031..2144351 (-) | 321 | WP_000219666.1 | hypothetical protein | - |
| A6V38_RS11310 (A6V38_11300) | - | 2144352..2144519 (-) | 168 | WP_000066022.1 | DUF1270 domain-containing protein | - |
| A6V38_RS11315 (A6V38_11305) | - | 2144531..2144794 (-) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| A6V38_RS16305 | - | 2144943..2145042 (-) | 100 | Protein_2092 | hypothetical protein | - |
| A6V38_RS11325 (A6V38_11315) | - | 2145058..2145810 (-) | 753 | WP_001148641.1 | phage antirepressor KilAC domain-containing protein | - |
| A6V38_RS11330 (A6V38_11320) | - | 2145967..2146275 (-) | 309 | WP_001153965.1 | hypothetical protein | - |
| A6V38_RS11335 (A6V38_11325) | - | 2146290..2146508 (-) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| A6V38_RS11340 (A6V38_11330) | - | 2146650..2147369 (+) | 720 | WP_000358221.1 | XRE family transcriptional regulator | - |
| A6V38_RS11345 (A6V38_11335) | - | 2147569..2147751 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| A6V38_RS11350 (A6V38_11340) | - | 2147787..2147933 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| A6V38_RS11355 (A6V38_11345) | - | 2147930..2148544 (-) | 615 | WP_000191459.1 | hypothetical protein | - |
| A6V38_RS11360 (A6V38_11350) | - | 2148652..2149689 (+) | 1038 | WP_084939538.1 | site-specific integrase | - |
| A6V38_RS11365 (A6V38_11355) | sph | 2149746..2150570 (+) | 825 | Protein_2101 | sphingomyelin phosphodiesterase | - |
| A6V38_RS11370 (A6V38_11360) | lukG | 2150808..2151824 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| A6V38_RS11375 (A6V38_11365) | lukH | 2151846..2152901 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| A6V38_RS11380 (A6V38_11370) | - | 2153336..2154559 (+) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| A6V38_RS11385 (A6V38_11380) | - | 2154931..2155776 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| A6V38_RS11390 (A6V38_11385) | - | 2155838..2156749 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| A6V38_RS11395 (A6V38_11390) | - | 2156910..2158217 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| A6V38_RS11405 (A6V38_11400) | - | 2159070..2159513 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| A6V38_RS11410 (A6V38_11405) | - | 2159619..2160055 (-) | 437 | Protein_2109 | hypothetical protein | - |
| A6V38_RS11415 (A6V38_11410) | - | 2160373..2160963 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| A6V38_RS11420 (A6V38_11415) | - | 2160960..2161172 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| A6V38_RS11425 (A6V38_11420) | - | 2161233..2161779 (+) | 547 | Protein_2112 | site-specific integrase | - |
| A6V38_RS11430 (A6V38_11425) | groL | 2161874..2163490 (-) | 1617 | WP_000240653.1 | chaperonin GroEL | - |
| A6V38_RS11435 (A6V38_11430) | groES | 2163566..2163850 (-) | 285 | WP_000917288.1 | co-chaperone GroES | - |
| A6V38_RS11440 (A6V38_11435) | mroQ | 2164025..2164768 (+) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| A6V38_RS11445 (A6V38_11440) | - | 2164793..2166052 (-) | 1260 | WP_000120305.1 | SdrH family protein | - |
| A6V38_RS11450 (A6V38_11445) | - | 2166249..2166875 (+) | 627 | WP_000522384.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=179941 A6V38_RS11285 WP_000934385.1 2142402..2142830(-) (ssbA) [Staphylococcus aureus strain M92]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=179941 A6V38_RS11285 WP_000934385.1 2142402..2142830(-) (ssbA) [Staphylococcus aureus strain M92]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |