Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | A4V11_RS04355 | Genome accession | NZ_CP015206 |
| Coordinates | 898020..898445 (-) | Length | 141 a.a. |
| NCBI ID | WP_070366333.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain ZPA017 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 866973..905121 | 898020..898445 | within | 0 |
Gene organization within MGE regions
Location: 866973..905121
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A4V11_RS04160 (A4V11_04155) | - | 866973..867836 (-) | 864 | WP_065124661.1 | energy-coupling factor ABC transporter ATP-binding protein | - |
| A4V11_RS04165 (A4V11_04160) | - | 867812..868654 (-) | 843 | WP_070366308.1 | energy-coupling factor transporter ATPase | - |
| A4V11_RS04170 (A4V11_04165) | - | 869586..870272 (-) | 687 | WP_070366309.1 | DUF3800 domain-containing protein | - |
| A4V11_RS04175 (A4V11_04170) | - | 870388..871509 (-) | 1122 | WP_081335293.1 | peptidoglycan recognition family protein | - |
| A4V11_RS04180 (A4V11_04175) | - | 871493..871735 (-) | 243 | WP_070366310.1 | phage holin | - |
| A4V11_RS04185 (A4V11_04180) | - | 871735..871962 (-) | 228 | WP_070366790.1 | hypothetical protein | - |
| A4V11_RS04190 (A4V11_04185) | - | 872126..874531 (-) | 2406 | WP_070366311.1 | BppU family phage baseplate upper protein | - |
| A4V11_RS04195 (A4V11_04190) | - | 874535..874948 (-) | 414 | WP_070366312.1 | hypothetical protein | - |
| A4V11_RS04200 (A4V11_04195) | - | 874948..877893 (-) | 2946 | WP_070366313.1 | peptidoglycan amidohydrolase family protein | - |
| A4V11_RS04205 (A4V11_04200) | - | 877893..878657 (-) | 765 | WP_070366314.1 | phage tail protein | - |
| A4V11_RS04210 (A4V11_04205) | - | 878657..881494 (-) | 2838 | WP_070366315.1 | tape measure protein | - |
| A4V11_RS04215 (A4V11_04210) | - | 881478..881756 (-) | 279 | WP_237028531.1 | hypothetical protein | - |
| A4V11_RS04220 (A4V11_04215) | - | 881903..882244 (-) | 342 | WP_070366317.1 | tail assembly chaperone | - |
| A4V11_RS04225 (A4V11_04220) | - | 882317..882973 (-) | 657 | WP_070366318.1 | phage major tail protein, TP901-1 family | - |
| A4V11_RS04230 (A4V11_04225) | - | 882985..883368 (-) | 384 | WP_070366319.1 | hypothetical protein | - |
| A4V11_RS04235 (A4V11_04230) | - | 883393..883734 (-) | 342 | WP_070366320.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| A4V11_RS04240 (A4V11_04235) | - | 883727..884035 (-) | 309 | WP_070366321.1 | hypothetical protein | - |
| A4V11_RS04245 (A4V11_04240) | - | 884040..884405 (-) | 366 | WP_070366322.1 | phage head-tail connector protein | - |
| A4V11_RS04250 (A4V11_04245) | - | 884416..884682 (-) | 267 | WP_081335296.1 | Ig-like domain-containing protein | - |
| A4V11_RS04255 (A4V11_04250) | - | 884700..885518 (-) | 819 | WP_070366324.1 | N4-gp56 family major capsid protein | - |
| A4V11_RS04260 (A4V11_04255) | - | 885518..886234 (-) | 717 | WP_002830727.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| A4V11_RS04265 (A4V11_04260) | - | 886339..887322 (-) | 984 | WP_002830728.1 | minor capsid protein | - |
| A4V11_RS04270 (A4V11_04265) | - | 887291..888625 (-) | 1335 | WP_002830730.1 | phage portal protein | - |
| A4V11_RS04275 (A4V11_04270) | - | 888707..890053 (-) | 1347 | WP_070366325.1 | PBSX family phage terminase large subunit | - |
| A4V11_RS04280 (A4V11_04275) | - | 890046..890537 (-) | 492 | WP_070366326.1 | terminase small subunit | - |
| A4V11_RS04285 (A4V11_04280) | - | 890616..891215 (-) | 600 | WP_070366327.1 | hypothetical protein | - |
| A4V11_RS04295 (A4V11_04290) | - | 891775..892218 (-) | 444 | WP_002830733.1 | hypothetical protein | - |
| A4V11_RS04300 (A4V11_04295) | - | 892418..892606 (-) | 189 | WP_036672512.1 | hypothetical protein | - |
| A4V11_RS04305 (A4V11_04300) | - | 892793..893041 (-) | 249 | WP_002830734.1 | hypothetical protein | - |
| A4V11_RS04310 (A4V11_04305) | - | 893223..893435 (-) | 213 | WP_036672514.1 | hypothetical protein | - |
| A4V11_RS04315 (A4V11_04310) | - | 893428..893673 (-) | 246 | WP_036672515.1 | hypothetical protein | - |
| A4V11_RS04320 (A4V11_04315) | - | 893674..893967 (-) | 294 | WP_002830735.1 | hypothetical protein | - |
| A4V11_RS04325 (A4V11_04320) | - | 894134..894505 (-) | 372 | WP_002830736.1 | hypothetical protein | - |
| A4V11_RS10460 | - | 894492..894641 (-) | 150 | WP_167626491.1 | hypothetical protein | - |
| A4V11_RS04330 (A4V11_04325) | - | 894638..895039 (-) | 402 | WP_070366328.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A4V11_RS04335 (A4V11_04330) | - | 895032..895652 (-) | 621 | WP_070366329.1 | RNA polymerase subunit sigma-70 | - |
| A4V11_RS04340 (A4V11_04335) | - | 895770..896585 (-) | 816 | WP_070366330.1 | ATP-binding protein | - |
| A4V11_RS04345 (A4V11_04340) | - | 896566..897330 (-) | 765 | WP_070366331.1 | conserved phage C-terminal domain-containing protein | - |
| A4V11_RS04350 (A4V11_04345) | - | 897308..898009 (-) | 702 | WP_070366332.1 | putative HNHc nuclease | - |
| A4V11_RS04355 (A4V11_04350) | ssb | 898020..898445 (-) | 426 | WP_070366333.1 | single-stranded DNA-binding protein | Machinery gene |
| A4V11_RS04360 (A4V11_04355) | - | 898438..899130 (-) | 693 | WP_070366334.1 | ERF family protein | - |
| A4V11_RS04365 (A4V11_04360) | - | 899131..899586 (-) | 456 | WP_237028533.1 | chromosome segregation protein SMC | - |
| A4V11_RS10415 (A4V11_04365) | - | 899707..900024 (-) | 318 | WP_070366336.1 | hypothetical protein | - |
| A4V11_RS04375 (A4V11_04370) | - | 900121..900327 (-) | 207 | WP_070366337.1 | helix-turn-helix transcriptional regulator | - |
| A4V11_RS04380 (A4V11_04375) | - | 900396..901130 (-) | 735 | WP_070366338.1 | Rha family transcriptional regulator | - |
| A4V11_RS04385 (A4V11_04380) | - | 901144..901353 (-) | 210 | WP_065124225.1 | helix-turn-helix domain-containing protein | - |
| A4V11_RS04390 (A4V11_04385) | - | 901610..901951 (+) | 342 | WP_002831842.1 | helix-turn-helix domain-containing protein | - |
| A4V11_RS04395 (A4V11_04390) | - | 901960..902406 (+) | 447 | WP_002830701.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A4V11_RS04400 (A4V11_04395) | - | 902431..902991 (+) | 561 | WP_002830700.1 | hypothetical protein | - |
| A4V11_RS04405 | - | 903010..903900 (+) | 891 | WP_070366339.1 | DUF5067 domain-containing protein | - |
| A4V11_RS04410 (A4V11_04405) | - | 904042..905121 (+) | 1080 | WP_070366340.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15596.28 Da Isoelectric Point: 6.9831
>NTDB_id=177508 A4V11_RS04355 WP_070366333.1 898020..898445(-) (ssb) [Pediococcus acidilactici strain ZPA017]
MINRTILIGRLTKDAELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFANFTRKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDDLPF
MINRTILIGRLTKDAELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFANFTRKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=177508 A4V11_RS04355 WP_070366333.1 898020..898445(-) (ssb) [Pediococcus acidilactici strain ZPA017]
ATGATTAATCGAACAATACTAATAGGACGCTTAACTAAAGATGCTGAGCTTCGCCACACAGCGAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACTAACTCACAGGGTGAACGTGAAGCGGATTTCATTAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCCAACTTCACGCGTAAAGGTTCTCTAGTAGGCATTGAAGGGCGGATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCAGGAGATCCATTCGCTAATGGTGGGCAGTCAATTGATA
TTGGTGACGACGATTTACCGTTCTAG
ATGATTAATCGAACAATACTAATAGGACGCTTAACTAAAGATGCTGAGCTTCGCCACACAGCGAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACTAACTCACAGGGTGAACGTGAAGCGGATTTCATTAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCCAACTTCACGCGTAAAGGTTCTCTAGTAGGCATTGAAGGGCGGATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCAGGAGATCCATTCGCTAATGGTGGGCAGTCAATTGATA
TTGGTGACGACGATTTACCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.709 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.667 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.185 |
76.596 |
0.461 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.845 |
100 |
0.411 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.845 |
100 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
37.324 |
100 |
0.376 |