Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A2G56_RS06420 | Genome accession | NZ_CP014835 |
| Coordinates | 1437104..1437499 (-) | Length | 131 a.a. |
| NCBI ID | WP_018380740.1 | Uniprot ID | - |
| Organism | Streptococcus halotolerans strain HTS9 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1415806..1440796 | 1437104..1437499 | within | 0 |
Gene organization within MGE regions
Location: 1415806..1440796
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A2G56_RS06340 | - | 1415806..1416825 (+) | 1020 | WP_172793788.1 | IS30 family transposase | - |
| A2G56_RS06345 | polA | 1417130..1419766 (+) | 2637 | WP_062710537.1 | DNA polymerase I | - |
| A2G56_RS06350 | - | 1420147..1421487 (-) | 1341 | WP_062710540.1 | MFS transporter | - |
| A2G56_RS06355 | - | 1421602..1422594 (+) | 993 | WP_062710543.1 | helix-turn-helix transcriptional regulator | - |
| A2G56_RS06360 | - | 1422633..1423892 (-) | 1260 | WP_062708466.1 | ISL3 family transposase | - |
| A2G56_RS06365 | - | 1424196..1426646 (+) | 2451 | WP_062710546.1 | SEC10/PgrA surface exclusion domain-containing protein | - |
| A2G56_RS06370 | - | 1426691..1428037 (+) | 1347 | WP_062710550.1 | LPXTG cell wall anchor domain-containing protein | - |
| A2G56_RS10250 | - | 1428339..1428821 (+) | 483 | WP_157761206.1 | DUF4767 domain-containing protein | - |
| A2G56_RS06385 | - | 1428846..1430054 (+) | 1209 | WP_062710558.1 | DUF4767 domain-containing protein | - |
| A2G56_RS06390 | groL | 1430465..1432087 (-) | 1623 | WP_062710561.1 | chaperonin GroEL | - |
| A2G56_RS06395 | groES | 1432243..1432527 (-) | 285 | WP_172793789.1 | co-chaperone GroES | - |
| A2G56_RS06400 | - | 1432692..1432982 (-) | 291 | WP_062710568.1 | hypothetical protein | - |
| A2G56_RS10255 | - | 1433002..1433187 (-) | 186 | Protein_1270 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| A2G56_RS06405 | - | 1433204..1433995 (-) | 792 | WP_062710570.1 | Cof-type HAD-IIB family hydrolase | - |
| A2G56_RS06410 | - | 1434190..1435830 (-) | 1641 | WP_062710573.1 | ABC transporter ATP-binding protein | - |
| A2G56_RS06415 | - | 1435831..1436802 (-) | 972 | WP_062710577.1 | ThiF family adenylyltransferase | - |
| A2G56_RS06420 | ssbA | 1437104..1437499 (-) | 396 | WP_018380740.1 | single-stranded DNA-binding protein | Machinery gene |
| A2G56_RS10675 | - | 1437707..1437937 (+) | 231 | WP_237334441.1 | hypothetical protein | - |
| A2G56_RS06430 | ytpR | 1437958..1438584 (-) | 627 | WP_062710582.1 | YtpR family tRNA-binding protein | - |
| A2G56_RS06435 | - | 1438590..1438904 (-) | 315 | WP_062710585.1 | thioredoxin family protein | - |
| A2G56_RS06440 | - | 1438901..1439182 (-) | 282 | WP_062710589.1 | DUF4651 domain-containing protein | - |
| A2G56_RS06445 | - | 1439374..1439574 (+) | 201 | WP_062710592.1 | cold-shock protein | - |
| A2G56_RS06450 | pepA | 1439732..1440796 (+) | 1065 | WP_062710595.1 | glutamyl aminopeptidase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14807.80 Da Isoelectric Point: 5.9497
>NTDB_id=174482 A2G56_RS06420 WP_018380740.1 1437104..1437499(-) (ssbA) [Streptococcus halotolerans strain HTS9]
MYNKTILIGRLVATPEVVKTPNDKSVARVTVAVNRRFKGKDGEREADFINVVFWGRLAETLASYGTKGSLISLDGELRTR
SYEKDGQRHYMTEVLGQSFQLLESRAQRAMRENNVAADLADLVLEEEELPF
MYNKTILIGRLVATPEVVKTPNDKSVARVTVAVNRRFKGKDGEREADFINVVFWGRLAETLASYGTKGSLISLDGELRTR
SYEKDGQRHYMTEVLGQSFQLLESRAQRAMRENNVAADLADLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=174482 A2G56_RS06420 WP_018380740.1 1437104..1437499(-) (ssbA) [Streptococcus halotolerans strain HTS9]
ATGTATAATAAAACTATTTTAATCGGTCGTTTGGTGGCAACACCAGAGGTAGTAAAAACTCCCAATGATAAATCTGTTGC
GCGTGTTACCGTTGCTGTCAATCGTCGCTTTAAAGGTAAGGATGGTGAGCGAGAAGCTGATTTTATCAATGTGGTCTTTT
GGGGGCGTTTGGCAGAAACCTTAGCGTCTTATGGAACGAAGGGTAGCTTGATTTCATTAGATGGTGAGCTGCGTACGCGT
TCTTATGAAAAAGATGGGCAAAGACACTATATGACAGAAGTTTTGGGACAATCTTTCCAATTACTCGAAAGTCGTGCCCA
ACGTGCTATGCGTGAAAATAATGTTGCAGCGGATCTGGCTGACCTTGTTCTTGAGGAAGAGGAGTTGCCGTTTTGA
ATGTATAATAAAACTATTTTAATCGGTCGTTTGGTGGCAACACCAGAGGTAGTAAAAACTCCCAATGATAAATCTGTTGC
GCGTGTTACCGTTGCTGTCAATCGTCGCTTTAAAGGTAAGGATGGTGAGCGAGAAGCTGATTTTATCAATGTGGTCTTTT
GGGGGCGTTTGGCAGAAACCTTAGCGTCTTATGGAACGAAGGGTAGCTTGATTTCATTAGATGGTGAGCTGCGTACGCGT
TCTTATGAAAAAGATGGGCAAAGACACTATATGACAGAAGTTTTGGGACAATCTTTCCAATTACTCGAAAGTCGTGCCCA
ACGTGCTATGCGTGAAAATAATGTTGCAGCGGATCTGGCTGACCTTGTTCTTGAGGAAGAGGAGTTGCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
83.206 |
100 |
0.832 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus mitis SK321 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
75.573 |
100 |
0.756 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
63.158 |
87.023 |
0.55 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
80.916 |
0.42 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
44.068 |
90.076 |
0.397 |