Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | AYM25_RS08505 | Genome accession | NZ_CP014407 |
| Coordinates | 1658625..1658936 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR12 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1653625..1663936
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM25_RS08470 (AYM25_08230) | gcvPA | 1654127..1655473 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| AYM25_RS08475 (AYM25_08235) | gcvT | 1655493..1656584 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AYM25_RS08480 (AYM25_08240) | - | 1656743..1657267 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| AYM25_RS08485 (AYM25_08245) | - | 1657257..1657403 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| AYM25_RS08490 (AYM25_08250) | comGF | 1657500..1657997 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AYM25_RS08495 (AYM25_08255) | comGE | 1657915..1658214 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| AYM25_RS08500 (AYM25_08260) | comGD | 1658201..1658647 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AYM25_RS08505 (AYM25_08265) | comGC | 1658625..1658936 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AYM25_RS08510 (AYM25_08270) | comGB | 1658950..1660020 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AYM25_RS08515 (AYM25_08275) | comGA | 1659992..1660966 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AYM25_RS08520 (AYM25_08280) | - | 1661018..1661641 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| AYM25_RS08525 (AYM25_08285) | - | 1661638..1661967 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| AYM25_RS08530 (AYM25_08290) | - | 1661967..1662953 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| AYM25_RS08535 (AYM25_08295) | - | 1662950..1663153 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=171153 AYM25_RS08505 WP_000472256.1 1658625..1658936(-) (comGC) [Staphylococcus aureus strain USA300-SUR12]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=171153 AYM25_RS08505 WP_000472256.1 1658625..1658936(-) (comGC) [Staphylococcus aureus strain USA300-SUR12]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |