Detailed information NTG0157597

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACH32_RS00560
• Genome accession: NZ_CP012756
• Coordinates: 105346..105657 (-)
• Length: 103 a.a.
• NCBI ID: WP_060649583.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain JS395
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 100346..110657

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACH32_RS00525 (ACH32_00520)	gcvPA	100848..102194 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
ACH32_RS00530 (ACH32_00525)	gcvT	102214..103305 (-)	1092	WP_000093340.1	glycine cleavage system aminomethyltransferase GcvT	-
ACH32_RS00535 (ACH32_00530)	-	103464..103988 (-)	525	WP_001015120.1	shikimate kinase	-
ACH32_RS00540 (ACH32_00535)	-	103978..104124 (-)	147	WP_001789879.1	hypothetical protein	-
ACH32_RS00545 (ACH32_00540)	comGF	104221..104718 (-)	498	WP_001796472.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACH32_RS00550 (ACH32_00545)	comGE	104636..104935 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
ACH32_RS00555 (ACH32_00550)	comGD	104922..105368 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACH32_RS00560 (ACH32_00555)	comGC	105346..105657 (-)	312	WP_060649583.1	competence type IV pilus major pilin ComGC	Machinery gene
ACH32_RS00565 (ACH32_00560)	comGB	105671..106741 (-)	1071	WP_000776414.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACH32_RS00570 (ACH32_00565)	comGA	106713..107687 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
ACH32_RS00575 (ACH32_00570)	-	107739..108362 (-)	624	WP_001223009.1	MBL fold metallo-hydrolase	-
ACH32_RS00580 (ACH32_00575)	-	108359..108688 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
ACH32_RS00585 (ACH32_00580)	-	108688..109674 (-)	987	WP_000161307.1	ROK family glucokinase	-
ACH32_RS00590 (ACH32_00585)	-	109671..109874 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11284.34 Da
• Isoelectric Point: 8.5268

>NTDB_id=157597 ACH32_RS00560 WP_060649583.1 105346..105657(-) (comGC) [Staphylococcus aureus strain JS395]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAPKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=157597 ACH32_RS00560 WP_060649583.1 105346..105657(-) (comGC) [Staphylococcus aureus strain JS395]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACCAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC/cglC	Streptococcus pneumoniae TIGR4	45.098	99.029	0.447
comGC/cglC	Streptococcus mitis NCTC 12261	51.19	81.553	0.417
comGC/cglC	Streptococcus mitis SK321	51.19	81.553	0.417
comGC/cglC	Streptococcus pneumoniae R6	50	81.553	0.408
comGC/cglC	Streptococcus pneumoniae Rx1	50	81.553	0.408
comGC/cglC	Streptococcus pneumoniae D39	50	81.553	0.408
comYC	Streptococcus gordonii str. Challis substr. CH1	41.837	95.146	0.398
comYC	Streptococcus suis isolate S10	50	73.786	0.369
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369