Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AMR84_RS01185 | Genome accession | NZ_CP012503 |
| Coordinates | 199571..199966 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282447.1 | Uniprot ID | A0AAV3JLT6 |
| Organism | Streptococcus agalactiae strain NGBS357 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 193312..232480 | 199571..199966 | within | 0 |
Gene organization within MGE regions
Location: 193312..232480
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AMR84_RS01135 (AMR84_01135) | - | 193312..193518 (+) | 207 | WP_000798241.1 | helix-turn-helix transcriptional regulator | - |
| AMR84_RS10915 | - | 193577..193714 (+) | 138 | WP_001865900.1 | hypothetical protein | - |
| AMR84_RS01140 (AMR84_01140) | - | 193755..194210 (+) | 456 | WP_000905673.1 | hypothetical protein | - |
| AMR84_RS01145 (AMR84_01145) | - | 194279..194944 (+) | 666 | WP_000008113.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AMR84_RS01150 (AMR84_01150) | proC | 194965..195735 (-) | 771 | WP_001865901.1 | pyrroline-5-carboxylate reductase | - |
| AMR84_RS01155 (AMR84_01155) | pepA | 195805..196872 (-) | 1068 | WP_001281323.1 | glutamyl aminopeptidase | - |
| AMR84_RS01160 (AMR84_01160) | - | 197057..197296 (-) | 240 | WP_000660180.1 | hypothetical protein | - |
| AMR84_RS01165 (AMR84_01165) | - | 197457..197741 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| AMR84_RS01170 (AMR84_01170) | - | 197738..198061 (+) | 324 | WP_000602781.1 | thioredoxin family protein | - |
| AMR84_RS01175 (AMR84_01175) | ytpR | 198094..198720 (+) | 627 | WP_000578328.1 | YtpR family tRNA-binding protein | - |
| AMR84_RS01180 (AMR84_01180) | - | 198774..199490 (-) | 717 | WP_000186185.1 | class I SAM-dependent methyltransferase | - |
| AMR84_RS01185 (AMR84_01185) | ssbA | 199571..199966 (+) | 396 | WP_000282447.1 | single-stranded DNA-binding protein | Machinery gene |
| AMR84_RS01190 (AMR84_01190) | - | 200090..200734 (+) | 645 | WP_000416612.1 | HAD family hydrolase | - |
| AMR84_RS01195 (AMR84_01195) | - | 200761..202506 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| AMR84_RS01200 (AMR84_01200) | - | 202487..203227 (+) | 741 | WP_000697630.1 | LytR/AlgR family response regulator transcription factor | - |
| AMR84_RS01205 (AMR84_01205) | - | 203397..203852 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| AMR84_RS01210 (AMR84_01210) | lrgB | 203854..204582 (+) | 729 | WP_000421726.1 | antiholin-like protein LrgB | - |
| AMR84_RS01215 (AMR84_01215) | - | 204825..206453 (+) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| AMR84_RS01220 (AMR84_01220) | - | 206566..207543 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| AMR84_RS01225 (AMR84_01225) | - | 207540..208361 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| AMR84_RS01230 (AMR84_01230) | - | 208373..209176 (+) | 804 | WP_000140984.1 | ABC transporter ATP-binding protein | - |
| AMR84_RS01235 (AMR84_01235) | - | 209160..209786 (+) | 627 | WP_000171311.1 | ABC transporter ATP-binding protein | - |
| AMR84_RS01240 (AMR84_01240) | treP | 210069..212099 (+) | 2031 | WP_000434616.1 | PTS system trehalose-specific EIIBC component | - |
| AMR84_RS01245 (AMR84_01245) | treC | 212321..213946 (+) | 1626 | WP_000151017.1 | alpha,alpha-phosphotrehalase | - |
| AMR84_RS01250 (AMR84_01250) | - | 214162..216198 (+) | 2037 | WP_000228180.1 | BglG family transcription antiterminator | - |
| AMR84_RS01255 (AMR84_01255) | - | 216201..216485 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| AMR84_RS01260 (AMR84_01260) | - | 216498..217853 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| AMR84_RS01265 (AMR84_01265) | - | 217856..218713 (+) | 858 | WP_000203489.1 | transketolase | - |
| AMR84_RS01270 (AMR84_01270) | - | 218710..219639 (+) | 930 | WP_001203821.1 | transketolase family protein | - |
| AMR84_RS01275 (AMR84_01275) | - | 219748..221007 (+) | 1260 | WP_001203071.1 | ferric reductase-like transmembrane domain-containing protein | - |
| AMR84_RS01280 (AMR84_01280) | rpsO | 221095..221364 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| AMR84_RS01285 (AMR84_01285) | pnp | 221745..223874 (+) | 2130 | WP_000043850.1 | polyribonucleotide nucleotidyltransferase | - |
| AMR84_RS01290 (AMR84_01290) | - | 223876..224628 (+) | 753 | WP_000204782.1 | SseB family protein | - |
| AMR84_RS01295 (AMR84_01295) | cysE | 224637..225221 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| AMR84_RS01300 (AMR84_01300) | - | 225231..225413 (+) | 183 | WP_000656476.1 | lipoprotein | - |
| AMR84_RS01305 (AMR84_01305) | cysS | 225410..226753 (+) | 1344 | WP_000591125.1 | cysteine--tRNA ligase | - |
| AMR84_RS01310 (AMR84_01310) | - | 226746..227132 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| AMR84_RS01315 (AMR84_01315) | rlmB | 227235..227990 (+) | 756 | WP_000178026.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| AMR84_RS01320 (AMR84_01320) | - | 227987..228505 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| AMR84_RS01325 (AMR84_01325) | - | 228598..229458 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| AMR84_RS11635 | - | 229995..230114 (+) | 120 | Protein_210 | helix-turn-helix transcriptional regulator | - |
| AMR84_RS01330 (AMR84_01330) | rplM | 230339..230785 (+) | 447 | WP_001865567.1 | 50S ribosomal protein L13 | - |
| AMR84_RS01335 (AMR84_01335) | rpsI | 230806..231198 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| AMR84_RS01340 (AMR84_01340) | - | 231326..232480 (-) | 1155 | WP_000022164.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14774.80 Da Isoelectric Point: 7.0189
>NTDB_id=154779 AMR84_RS01185 WP_000282447.1 199571..199966(+) (ssbA) [Streptococcus agalactiae strain NGBS357]
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=154779 AMR84_RS01185 WP_000282447.1 199571..199966(+) (ssbA) [Streptococcus agalactiae strain NGBS357]
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
80.916 |
100 |
0.809 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis SK321 |
76.336 |
100 |
0.763 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
60.526 |
87.023 |
0.527 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.018 |
86.26 |
0.397 |