Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | QT38_RS07615 | Genome accession | NZ_CP010297 |
| Coordinates | 1654743..1655054 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain ATCC BAA1680 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1630939..1657084 | 1654743..1655054 | within | 0 |
Gene organization within MGE regions
Location: 1630939..1657084
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QT38_RS07475 (QT38_08045) | - | 1630939..1631475 (-) | 537 | WP_077442703.1 | IS30 family transposase | - |
| QT38_RS07480 (QT38_08050) | - | 1631456..1631959 (-) | 504 | WP_000746375.1 | transposase | - |
| QT38_RS07485 (QT38_08055) | - | 1632068..1632424 (-) | 357 | WP_001255379.1 | cystatin-like fold lipoprotein | - |
| QT38_RS07490 (QT38_08060) | - | 1632480..1633070 (-) | 591 | WP_000810443.1 | hypothetical protein | - |
| QT38_RS07495 (QT38_08065) | - | 1633077..1634123 (-) | 1047 | WP_000247465.1 | CHAP domain-containing protein | - |
| QT38_RS07500 (QT38_08070) | - | 1634113..1635960 (-) | 1848 | WP_000681154.1 | CD3337/EF1877 family mobilome membrane protein | - |
| QT38_RS07505 (QT38_08075) | - | 1635965..1637323 (-) | 1359 | WP_001251211.1 | FtsK/SpoIIIE domain-containing protein | - |
| QT38_RS07510 (QT38_08080) | - | 1637377..1639872 (-) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| QT38_RS07515 (QT38_08085) | - | 1639907..1640290 (-) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| QT38_RS07520 (QT38_08090) | - | 1640302..1640562 (-) | 261 | WP_000015639.1 | TcpD family membrane protein | - |
| QT38_RS07525 (QT38_08095) | - | 1640567..1641622 (-) | 1056 | WP_000692003.1 | conjugal transfer protein | - |
| QT38_RS07530 (QT38_08100) | - | 1641683..1642774 (-) | 1092 | WP_000172939.1 | replication initiation factor domain-containing protein | - |
| QT38_RS07535 (QT38_08105) | - | 1642949..1643251 (-) | 303 | WP_000386891.1 | hypothetical protein | - |
| QT38_RS07540 (QT38_08110) | - | 1643265..1643585 (-) | 321 | WP_000805733.1 | DUF961 family protein | - |
| QT38_RS07545 (QT38_08115) | - | 1643736..1644020 (-) | 285 | WP_000134545.1 | hypothetical protein | - |
| QT38_RS07550 (QT38_08120) | efp | 1644415..1644972 (-) | 558 | WP_000626504.1 | elongation factor P | - |
| QT38_RS07555 (QT38_08125) | - | 1644998..1646059 (-) | 1062 | WP_000087107.1 | M24 family metallopeptidase | - |
| QT38_RS07560 (QT38_08130) | - | 1646164..1646745 (+) | 582 | WP_000737686.1 | hypothetical protein | - |
| QT38_RS07565 (QT38_08135) | - | 1646759..1646977 (+) | 219 | WP_001244298.1 | SA1362 family protein | - |
| QT38_RS07570 (QT38_08140) | - | 1647041..1647871 (-) | 831 | WP_000141108.1 | lipoate--protein ligase family protein | - |
| QT38_RS07575 (QT38_08145) | - | 1648029..1648415 (+) | 387 | WP_001276571.1 | rhodanese-like domain-containing protein | - |
| QT38_RS07580 (QT38_08150) | gcvPB | 1648780..1650252 (-) | 1473 | WP_000202189.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
| QT38_RS07585 (QT38_08155) | gcvPA | 1650245..1651591 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| QT38_RS07590 (QT38_08160) | gcvT | 1651611..1652702 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QT38_RS07595 (QT38_08165) | - | 1652861..1653385 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| QT38_RS14405 (QT38_08170) | - | 1653375..1653521 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| QT38_RS07600 (QT38_08175) | comGF | 1653618..1654115 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| QT38_RS07605 (QT38_08180) | comGE | 1654033..1654332 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| QT38_RS07610 (QT38_08185) | comGD | 1654319..1654765 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| QT38_RS07615 (QT38_08190) | comGC | 1654743..1655054 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QT38_RS07620 (QT38_08195) | comGB | 1655068..1656138 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| QT38_RS07625 (QT38_08200) | comGA | 1656110..1657084 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=135941 QT38_RS07615 WP_000472256.1 1654743..1655054(-) (comGC) [Staphylococcus aureus strain ATCC BAA1680]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=135941 QT38_RS07615 WP_000472256.1 1654743..1655054(-) (comGC) [Staphylococcus aureus strain ATCC BAA1680]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |