Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   QT38_RS07610 Genome accession   NZ_CP010297
Coordinates   1654319..1654765 (-) Length   148 a.a.
NCBI ID   WP_001791635.1    Uniprot ID   -
Organism   Staphylococcus aureus strain ATCC BAA1680     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1630939..1657084 1654319..1654765 within 0


Gene organization within MGE regions


Location: 1630939..1657084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QT38_RS07475 (QT38_08045) - 1630939..1631475 (-) 537 WP_077442703.1 IS30 family transposase -
  QT38_RS07480 (QT38_08050) - 1631456..1631959 (-) 504 WP_000746375.1 transposase -
  QT38_RS07485 (QT38_08055) - 1632068..1632424 (-) 357 WP_001255379.1 cystatin-like fold lipoprotein -
  QT38_RS07490 (QT38_08060) - 1632480..1633070 (-) 591 WP_000810443.1 hypothetical protein -
  QT38_RS07495 (QT38_08065) - 1633077..1634123 (-) 1047 WP_000247465.1 CHAP domain-containing protein -
  QT38_RS07500 (QT38_08070) - 1634113..1635960 (-) 1848 WP_000681154.1 CD3337/EF1877 family mobilome membrane protein -
  QT38_RS07505 (QT38_08075) - 1635965..1637323 (-) 1359 WP_001251211.1 FtsK/SpoIIIE domain-containing protein -
  QT38_RS07510 (QT38_08080) - 1637377..1639872 (-) 2496 WP_001049264.1 ATP-binding protein -
  QT38_RS07515 (QT38_08085) - 1639907..1640290 (-) 384 WP_000358144.1 TcpE family conjugal transfer membrane protein -
  QT38_RS07520 (QT38_08090) - 1640302..1640562 (-) 261 WP_000015639.1 TcpD family membrane protein -
  QT38_RS07525 (QT38_08095) - 1640567..1641622 (-) 1056 WP_000692003.1 conjugal transfer protein -
  QT38_RS07530 (QT38_08100) - 1641683..1642774 (-) 1092 WP_000172939.1 replication initiation factor domain-containing protein -
  QT38_RS07535 (QT38_08105) - 1642949..1643251 (-) 303 WP_000386891.1 hypothetical protein -
  QT38_RS07540 (QT38_08110) - 1643265..1643585 (-) 321 WP_000805733.1 DUF961 family protein -
  QT38_RS07545 (QT38_08115) - 1643736..1644020 (-) 285 WP_000134545.1 hypothetical protein -
  QT38_RS07550 (QT38_08120) efp 1644415..1644972 (-) 558 WP_000626504.1 elongation factor P -
  QT38_RS07555 (QT38_08125) - 1644998..1646059 (-) 1062 WP_000087107.1 M24 family metallopeptidase -
  QT38_RS07560 (QT38_08130) - 1646164..1646745 (+) 582 WP_000737686.1 hypothetical protein -
  QT38_RS07565 (QT38_08135) - 1646759..1646977 (+) 219 WP_001244298.1 SA1362 family protein -
  QT38_RS07570 (QT38_08140) - 1647041..1647871 (-) 831 WP_000141108.1 lipoate--protein ligase family protein -
  QT38_RS07575 (QT38_08145) - 1648029..1648415 (+) 387 WP_001276571.1 rhodanese-like domain-containing protein -
  QT38_RS07580 (QT38_08150) gcvPB 1648780..1650252 (-) 1473 WP_000202189.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPB -
  QT38_RS07585 (QT38_08155) gcvPA 1650245..1651591 (-) 1347 WP_000019687.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPA -
  QT38_RS07590 (QT38_08160) gcvT 1651611..1652702 (-) 1092 WP_000093349.1 glycine cleavage system aminomethyltransferase GcvT -
  QT38_RS07595 (QT38_08165) - 1652861..1653385 (-) 525 WP_001015117.1 shikimate kinase -
  QT38_RS14405 (QT38_08170) - 1653375..1653521 (-) 147 WP_001789879.1 hypothetical protein -
  QT38_RS07600 (QT38_08175) comGF 1653618..1654115 (-) 498 WP_001789864.1 competence type IV pilus minor pilin ComGF Machinery gene
  QT38_RS07605 (QT38_08180) comGE 1654033..1654332 (-) 300 WP_000844413.1 hypothetical protein Machinery gene
  QT38_RS07610 (QT38_08185) comGD 1654319..1654765 (-) 447 WP_001791635.1 competence type IV pilus minor pilin ComGD Machinery gene
  QT38_RS07615 (QT38_08190) comGC 1654743..1655054 (-) 312 WP_000472256.1 competence type IV pilus major pilin ComGC Machinery gene
  QT38_RS07620 (QT38_08195) comGB 1655068..1656138 (-) 1071 WP_000775708.1 competence type IV pilus assembly protein ComGB Machinery gene
  QT38_RS07625 (QT38_08200) comGA 1656110..1657084 (-) 975 WP_000697228.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 17199.34 Da        Isoelectric Point: 10.2908

>NTDB_id=135940 QT38_RS07610 WP_001791635.1 1654319..1654765(-) (comGD) [Staphylococcus aureus strain ATCC BAA1680]
MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSD
TIKVIENNNIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIYNNNSIYRIIFHIEKGRIRYEKL

Nucleotide


Download         Length: 447 bp        

>NTDB_id=135940 QT38_RS07610 WP_001791635.1 1654319..1654765(-) (comGD) [Staphylococcus aureus strain ATCC BAA1680]
ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTGGTAATGATGTTAATCAGTAT
ATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAATCTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTA
TTACTGAATTGAATTATATTAAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
ACTATTAAAGTAATAGAGAATAATAATATACGATTTCTAAAATTAAAAGTAGGCAAAATAATTAATGTTGCAAAAGTTGA
TATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTTGGTAGCATAACAATTTACAATAACAATTCAATTTATAGAA
TAATATTCCATATTGAAAAAGGAAGAATTCGTTATGAAAAGCTATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Staphylococcus aureus MW2

98.649

100

0.986

  comGD Staphylococcus aureus N315

98.649

100

0.986


Multiple sequence alignment