Detailed information NTG0130824

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: EP23_RS15635
• Genome accession: NZ_CP009623
• Coordinates: 729949..730260 (-)
• Length: 103 a.a.
• NCBI ID: WP_060552480.1
• Uniprot ID: -
• Organism: Staphylococcus agnetis strain 908
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 724949..735260

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EP23_RS15605 (EP23_03520)	gcvPA	725561..726910 (-)	1350	WP_060551122.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
EP23_RS15610 (EP23_03525)	gcvT	726922..728013 (-)	1092	WP_060551123.1	glycine cleavage system aminomethyltransferase GcvT	-
EP23_RS15615 (EP23_03530)	-	728165..728734 (-)	570	WP_060552479.1	shikimate kinase	-
EP23_RS15620 (EP23_12440)	-	728673..728885 (-)	213	WP_171509143.1	hypothetical protein	-
EP23_RS15625 (EP23_03535)	-	728854..729336 (-)	483	WP_060551124.1	competence type IV pilus minor pilin ComGF	-
EP23_RS15630 (EP23_03540)	comGD	729528..729959 (-)	432	WP_225906114.1	competence type IV pilus minor pilin ComGD	-
EP23_RS15635 (EP23_03545)	comGC	729949..730260 (-)	312	WP_060552480.1	competence type IV pilus major pilin ComGC	Machinery gene
EP23_RS24570	-	730281..730937 (-)	657	WP_253724562.1	type II secretion system F family protein	-
EP23_RS15645 (EP23_03555)	comGA	731291..732265 (-)	975	WP_060551125.1	competence type IV pilus ATPase ComGA	Machinery gene
EP23_RS15650 (EP23_03560)	-	732322..732945 (-)	624	WP_060551126.1	MBL fold metallo-hydrolase	-
EP23_RS15655 (EP23_03565)	-	732960..733271 (-)	312	WP_060551127.1	MTH1187 family thiamine-binding protein	-
EP23_RS15660 (EP23_03570)	-	733272..734258 (-)	987	WP_060551128.1	ROK family glucokinase	-
EP23_RS15665 (EP23_03575)	-	734255..734458 (-)	204	WP_037567684.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11494.66 Da
• Isoelectric Point: 9.0689

>NTDB_id=130824 EP23_RS15635 WP_060552480.1 729949..730260(-) (comGC) [Staphylococcus agnetis strain 908]
MIHMLKNKKGFTLIEMLLVLLIISVLLILIIPNIAKQSEHIQKTGCAAQLKLVDSQIEAYTLKYNRKPATIEELVQEGYI
KENQKNCKSGESITIRGGEAIAS

Nucleotide

• Length: 312 bp

>NTDB_id=130824 EP23_RS15635 WP_060552480.1 729949..730260(-) (comGC) [Staphylococcus agnetis strain 908]
ATGATTCACATGCTAAAAAATAAAAAAGGATTCACGCTAATTGAAATGTTGCTTGTATTACTGATTATTAGCGTTTTATT
AATTTTAATTATCCCAAACATAGCTAAACAATCTGAACACATTCAAAAAACAGGATGTGCTGCACAACTTAAACTTGTTG
ACAGTCAAATAGAAGCATATACATTAAAATACAATCGTAAACCAGCAACTATAGAAGAACTTGTTCAAGAAGGTTATATT
AAGGAGAATCAAAAGAATTGTAAAAGTGGTGAAAGCATCACAATCCGTGGTGGCGAGGCTATTGCATCGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	68.932	100	0.689
comGC	Staphylococcus aureus MW2	68.932	100	0.689
comGC	Bacillus subtilis subsp. subtilis str. 168	44.086	90.291	0.398
comYC	Streptococcus suis isolate S10	52.632	73.786	0.388
comYC	Streptococcus gordonii str. Challis substr. CH1	50.633	76.699	0.388
comGC/cglC	Streptococcus mitis SK321	51.316	73.786	0.379
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	73.786	0.379
comGC/cglC	Streptococcus pneumoniae R6	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae TIGR4	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae Rx1	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae D39	50	73.786	0.369
comYC	Streptococcus mutans UA140	48.101	76.699	0.369
comYC	Streptococcus mutans UA159	48.101	76.699	0.369