Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DX05_RS01335 | Genome accession | NZ_CP007572 |
| Coordinates | 229019..229414 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282446.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain GBS6 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 192991..269371 | 229019..229414 | within | 0 |
Gene organization within MGE regions
Location: 192991..269371
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DX05_RS01150 (DX05_01165) | - | 192991..193227 (+) | 237 | WP_041326054.1 | hypothetical protein | - |
| DX05_RS01155 (DX05_01170) | - | 193224..193574 (+) | 351 | WP_024053150.1 | HTH domain-containing protein | - |
| DX05_RS01160 (DX05_01175) | - | 193577..193849 (+) | 273 | WP_041326056.1 | hypothetical protein | - |
| DX05_RS01165 (DX05_01180) | - | 193846..194010 (+) | 165 | WP_041326058.1 | hypothetical protein | - |
| DX05_RS12010 | - | 193997..194143 (+) | 147 | WP_181970976.1 | hypothetical protein | - |
| DX05_RS01170 (DX05_01190) | - | 194145..195002 (+) | 858 | WP_041326060.1 | primase alpha helix C-terminal domain-containing protein | - |
| DX05_RS01175 (DX05_01195) | - | 195085..196533 (+) | 1449 | WP_041326850.1 | DNA primase family protein | - |
| DX05_RS01180 (DX05_01200) | - | 197391..197813 (+) | 423 | WP_225791875.1 | hypothetical protein | - |
| DX05_RS01185 (DX05_01205) | - | 197973..198416 (+) | 444 | WP_024053143.1 | DUF1492 domain-containing protein | - |
| DX05_RS01190 (DX05_01210) | - | 198464..199042 (+) | 579 | WP_024053142.1 | hypothetical protein | - |
| DX05_RS01195 (DX05_01215) | - | 199042..199377 (+) | 336 | WP_041326062.1 | hypothetical protein | - |
| DX05_RS01205 (DX05_01225) | - | 200156..200347 (+) | 192 | WP_003038349.1 | type II toxin-antitoxin system HicA family toxin | - |
| DX05_RS01210 (DX05_01230) | - | 200384..200764 (+) | 381 | WP_041326065.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DX05_RS01215 (DX05_01235) | tyrS | 201029..202288 (-) | 1260 | WP_041326067.1 | tyrosine--tRNA ligase | - |
| DX05_RS01220 (DX05_01240) | pbp1b | 202399..204696 (+) | 2298 | WP_041326069.1 | penicillin-binding protein PBP1B | - |
| DX05_RS01225 (DX05_01245) | rpoB | 205220..208795 (+) | 3576 | WP_000907191.1 | DNA-directed RNA polymerase subunit beta | - |
| DX05_RS01230 (DX05_01250) | rpoC | 208912..212562 (+) | 3651 | WP_000228729.1 | DNA-directed RNA polymerase subunit beta' | - |
| DX05_RS01235 (DX05_01255) | - | 212676..213041 (+) | 366 | WP_000285374.1 | DUF1033 family protein | - |
| DX05_RS01240 (DX05_01260) | ltrA | 213732..215009 (+) | 1278 | WP_001292556.1 | group II intron reverse transcriptase/maturase | - |
| DX05_RS01245 (DX05_01265) | - | 215059..216471 (-) | 1413 | WP_017771557.1 | IS1182 family transposase | - |
| DX05_RS01250 (DX05_01270) | comYA | 216636..217607 (+) | 972 | WP_000250798.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| DX05_RS01255 (DX05_01275) | comGB | 217501..218448 (+) | 948 | Protein_197 | competence type IV pilus assembly protein ComGB | - |
| DX05_RS01270 (DX05_01290) | comGF | 219976..220431 (+) | 456 | WP_000793378.1 | competence type IV pilus minor pilin ComGF | - |
| DX05_RS01275 (DX05_01295) | comGG | 220409..220780 (+) | 372 | WP_000601101.1 | competence type IV pilus minor pilin ComGG | - |
| DX05_RS01280 (DX05_01300) | comYH | 220895..221869 (+) | 975 | WP_001008569.1 | class I SAM-dependent methyltransferase | Machinery gene |
| DX05_RS01285 (DX05_01305) | - | 221901..223094 (+) | 1194 | WP_000047534.1 | acetate kinase | - |
| DX05_RS01290 | - | 223222..223414 (+) | 193 | Protein_203 | helix-turn-helix transcriptional regulator | - |
| DX05_RS11170 | - | 223393..223659 (+) | 267 | Protein_204 | hypothetical protein | - |
| DX05_RS01295 (DX05_01315) | - | 223728..224393 (+) | 666 | WP_000008108.1 | type II CAAX endopeptidase family protein | - |
| DX05_RS01300 (DX05_01320) | proC | 224414..225184 (-) | 771 | WP_001881026.1 | pyrroline-5-carboxylate reductase | - |
| DX05_RS01305 (DX05_01325) | pepA | 225254..226321 (-) | 1068 | WP_001281321.1 | glutamyl aminopeptidase | - |
| DX05_RS01310 (DX05_01330) | - | 226506..226745 (-) | 240 | WP_000660182.1 | hypothetical protein | - |
| DX05_RS01315 (DX05_01335) | - | 226906..227190 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| DX05_RS01320 (DX05_01340) | - | 227187..227510 (+) | 324 | WP_000602780.1 | thioredoxin family protein | - |
| DX05_RS01325 (DX05_01345) | ytpR | 227543..228169 (+) | 627 | WP_000578324.1 | YtpR family tRNA-binding protein | - |
| DX05_RS01330 (DX05_01350) | - | 228223..228938 (-) | 716 | Protein_212 | methyltransferase domain-containing protein | - |
| DX05_RS01335 (DX05_01355) | ssbA | 229019..229414 (+) | 396 | WP_000282446.1 | single-stranded DNA-binding protein | Machinery gene |
| DX05_RS01340 (DX05_01360) | - | 229538..230182 (+) | 645 | WP_000416614.1 | HAD family hydrolase | - |
| DX05_RS01345 (DX05_01365) | - | 230209..231954 (+) | 1746 | WP_000930328.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| DX05_RS01350 (DX05_01370) | - | 231935..232679 (+) | 745 | Protein_216 | LytTR family transcriptional regulator DNA-binding domain-containing protein | - |
| DX05_RS01355 (DX05_01375) | - | 232849..233304 (+) | 456 | WP_000683317.1 | CidA/LrgA family protein | - |
| DX05_RS01360 (DX05_01380) | lrgB | 233306..234034 (+) | 729 | WP_000421730.1 | antiholin-like protein LrgB | - |
| DX05_RS01365 (DX05_01385) | - | 234277..235905 (+) | 1629 | WP_000170509.1 | ABC transporter substrate-binding protein | - |
| DX05_RS01370 (DX05_01390) | - | 236018..236995 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| DX05_RS01375 (DX05_01395) | - | 236992..237813 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| DX05_RS01380 (DX05_01400) | - | 237825..238628 (+) | 804 | WP_000140980.1 | ABC transporter ATP-binding protein | - |
| DX05_RS01385 (DX05_01405) | - | 238612..239238 (+) | 627 | WP_000171306.1 | ABC transporter ATP-binding protein | - |
| DX05_RS01390 (DX05_01410) | treP | 239521..241551 (+) | 2031 | WP_000434616.1 | PTS system trehalose-specific EIIBC component | - |
| DX05_RS01395 (DX05_01415) | treC | 241773..243398 (+) | 1626 | WP_000151015.1 | alpha,alpha-phosphotrehalase | - |
| DX05_RS01400 (DX05_01420) | - | 243614..245650 (+) | 2037 | WP_000228186.1 | BglG family transcription antiterminator | - |
| DX05_RS01405 (DX05_01425) | - | 245653..245937 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| DX05_RS01410 (DX05_01430) | - | 245950..247305 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| DX05_RS01415 (DX05_01435) | - | 247308..248165 (+) | 858 | WP_000203493.1 | transketolase | - |
| DX05_RS01420 (DX05_01440) | - | 248162..249091 (+) | 930 | WP_001203822.1 | transketolase C-terminal domain-containing protein | - |
| DX05_RS01425 (DX05_01445) | - | 249200..250459 (+) | 1260 | WP_001203064.1 | ferric reductase-like transmembrane domain-containing protein | - |
| DX05_RS01430 (DX05_01450) | rpsO | 250547..250816 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| DX05_RS01435 (DX05_01455) | pnp | 251197..253326 (+) | 2130 | WP_000043841.1 | polyribonucleotide nucleotidyltransferase | - |
| DX05_RS01440 (DX05_01460) | - | 253328..254080 (+) | 753 | WP_000204781.1 | SseB family protein | - |
| DX05_RS01445 (DX05_01465) | cysE | 254089..254673 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| DX05_RS01450 (DX05_01470) | - | 254683..254865 (+) | 183 | WP_000656476.1 | lipoprotein | - |
| DX05_RS01455 (DX05_01475) | cysS | 254862..256205 (+) | 1344 | WP_000591130.1 | cysteine--tRNA ligase | - |
| DX05_RS01460 (DX05_01480) | - | 256198..256584 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| DX05_RS01465 (DX05_01485) | - | 256710..258179 (+) | 1470 | WP_041326110.1 | IS1182 family transposase | - |
| DX05_RS01470 (DX05_01490) | rlmB | 258247..259002 (+) | 756 | WP_000178021.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| DX05_RS01475 (DX05_01495) | - | 258999..259517 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| DX05_RS01480 (DX05_01500) | - | 259610..260470 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| DX05_RS01485 (DX05_01510) | - | 261008..261127 (+) | 120 | Protein_243 | helix-turn-helix domain-containing protein | - |
| DX05_RS01490 (DX05_01515) | rplM | 261352..261798 (+) | 447 | WP_001867156.1 | 50S ribosomal protein L13 | - |
| DX05_RS01495 (DX05_01520) | rpsI | 261819..262211 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| DX05_RS01500 (DX05_01525) | - | 262339..263493 (-) | 1155 | WP_000022172.1 | tyrosine-type recombinase/integrase | - |
| DX05_RS01505 (DX05_01530) | - | 263562..264113 (-) | 552 | WP_001097380.1 | helix-turn-helix transcriptional regulator | - |
| DX05_RS01510 (DX05_01535) | - | 264278..264571 (+) | 294 | WP_000331953.1 | hypothetical protein | - |
| DX05_RS01515 (DX05_01540) | - | 264712..264993 (+) | 282 | WP_000134666.1 | helix-turn-helix domain-containing protein | - |
| DX05_RS01520 (DX05_01545) | - | 264999..265326 (+) | 328 | Protein_250 | replication initiator protein A | - |
| DX05_RS01525 (DX05_01550) | - | 265330..265971 (+) | 642 | WP_000591144.1 | hypothetical protein | - |
| DX05_RS01535 (DX05_01560) | - | 266271..267146 (+) | 876 | WP_000421240.1 | hypothetical protein | - |
| DX05_RS01540 (DX05_01565) | - | 267182..267616 (+) | 435 | WP_001220479.1 | hypothetical protein | - |
| DX05_RS01545 (DX05_01570) | mobV | 267933..269189 (+) | 1257 | WP_000122836.1 | MobV family relaxase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14735.78 Da Isoelectric Point: 5.9381
>NTDB_id=121142 DX05_RS01335 WP_000282446.1 229019..229414(+) (ssbA) [Streptococcus agalactiae strain GBS6]
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWARLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQCAMRENNVSGDLSDLVLEEEELPF
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWARLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQCAMRENNVSGDLSDLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=121142 DX05_RS01335 WP_000282446.1 229019..229414(+) (ssbA) [Streptococcus agalactiae strain GBS6]
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
ACGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGCTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGTTAGAAAGCCGTGCCCA
ATGTGCTATGCGTGAAAATAATGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
ACGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGCTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGTTAGAAAGCCGTGCCCA
ATGTGCTATGCGTGAAAATAATGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
79.389 |
100 |
0.794 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
75.573 |
100 |
0.756 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
75.573 |
100 |
0.756 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
74.809 |
100 |
0.748 |
| ssbB/cilA | Streptococcus mitis SK321 |
74.809 |
100 |
0.748 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
59.649 |
87.023 |
0.519 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.018 |
86.26 |
0.397 |