Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACE4RJ_RS07380 | Genome accession | NZ_OZ059821 |
| Coordinates | 1502203..1502631 (+) | Length | 142 a.a. |
| NCBI ID | WP_016187439.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate H3_23S01314-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1493330..1535923 | 1502203..1502631 | within | 0 |
Gene organization within MGE regions
Location: 1493330..1535923
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACE4RJ_RS07295 | sufB | 1493330..1494727 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| ACE4RJ_RS07300 | - | 1494795..1495844 (-) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| ACE4RJ_RS07305 | - | 1495911..1496153 (-) | 243 | WP_016187262.1 | hypothetical protein | - |
| ACE4RJ_RS07310 | - | 1496164..1497147 (-) | 984 | WP_021285964.1 | glycosyltransferase family 2 protein | - |
| ACE4RJ_RS07315 | - | 1497199..1497873 (-) | 675 | WP_000142628.1 | XRE family transcriptional regulator | - |
| ACE4RJ_RS07320 | - | 1498065..1498304 (+) | 240 | WP_016187264.1 | helix-turn-helix transcriptional regulator | - |
| ACE4RJ_RS07325 | - | 1498319..1498480 (+) | 162 | WP_001153175.1 | hypothetical protein | - |
| ACE4RJ_RS07330 | - | 1498473..1498709 (-) | 237 | WP_021285963.1 | hypothetical protein | - |
| ACE4RJ_RS07335 | - | 1498774..1499514 (+) | 741 | WP_001576117.1 | phage antirepressor KilAC domain-containing protein | - |
| ACE4RJ_RS07340 | - | 1499539..1499742 (+) | 204 | Protein_1440 | hypothetical protein | - |
| ACE4RJ_RS07345 | - | 1499710..1499955 (-) | 246 | WP_016187267.1 | hypothetical protein | - |
| ACE4RJ_RS07350 | - | 1500026..1500247 (+) | 222 | WP_000977381.1 | hypothetical protein | - |
| ACE4RJ_RS07355 | - | 1500240..1500401 (+) | 162 | WP_000048124.1 | DUF1270 family protein | - |
| ACE4RJ_RS07360 | - | 1500504..1500806 (+) | 303 | WP_000163429.1 | DUF2482 family protein | - |
| ACE4RJ_RS07365 | - | 1500811..1501071 (+) | 261 | WP_021285962.1 | DUF1108 family protein | - |
| ACE4RJ_RS07370 | - | 1501086..1501565 (+) | 480 | WP_016187438.1 | siphovirus Gp157 family protein | - |
| ACE4RJ_RS07375 | - | 1501565..1502203 (+) | 639 | WP_001043063.1 | ERF family protein | - |
| ACE4RJ_RS07380 | ssbA | 1502203..1502631 (+) | 429 | WP_016187439.1 | single-stranded DNA-binding protein | Machinery gene |
| ACE4RJ_RS07385 | - | 1502645..1503340 (+) | 696 | WP_015980404.1 | putative HNHc nuclease | - |
| ACE4RJ_RS07390 | - | 1503312..1504115 (+) | 804 | WP_000504986.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACE4RJ_RS07395 | - | 1504125..1504898 (+) | 774 | WP_021285961.1 | ATP-binding protein | - |
| ACE4RJ_RS07400 | - | 1504892..1505053 (+) | 162 | WP_000237154.1 | hypothetical protein | - |
| ACE4RJ_RS07405 | - | 1505066..1505287 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| ACE4RJ_RS07410 | - | 1505297..1505701 (+) | 405 | WP_000049794.1 | DUF1064 domain-containing protein | - |
| ACE4RJ_RS07415 | - | 1505706..1505891 (+) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| ACE4RJ_RS07420 | - | 1505892..1506197 (+) | 306 | WP_000101252.1 | hypothetical protein | - |
| ACE4RJ_RS07425 | - | 1506325..1506684 (+) | 360 | WP_016187441.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACE4RJ_RS07430 | - | 1506684..1506941 (+) | 258 | WP_021285960.1 | DUF3310 domain-containing protein | - |
| ACE4RJ_RS07435 | - | 1506944..1507144 (+) | 201 | WP_000224767.1 | hypothetical protein | - |
| ACE4RJ_RS07440 | - | 1507141..1507830 (+) | 690 | WP_000097190.1 | N-6 DNA methylase | - |
| ACE4RJ_RS07445 | - | 1507844..1508056 (+) | 213 | WP_000695732.1 | hypothetical protein | - |
| ACE4RJ_RS07450 | - | 1508053..1508459 (+) | 407 | Protein_1462 | hypothetical protein | - |
| ACE4RJ_RS07455 | - | 1508456..1508647 (+) | 192 | WP_021285959.1 | hypothetical protein | - |
| ACE4RJ_RS07460 | - | 1508647..1509033 (+) | 387 | Protein_1464 | acetyltransferase | - |
| ACE4RJ_RS07465 | - | 1509010..1509258 (+) | 249 | WP_025176536.1 | DUF1024 family protein | - |
| ACE4RJ_RS07470 | - | 1509251..1509787 (+) | 537 | WP_000185693.1 | dUTPase | - |
| ACE4RJ_RS07475 | - | 1509824..1510030 (+) | 207 | WP_000195770.1 | DUF1381 domain-containing protein | - |
| ACE4RJ_RS07480 | - | 1510027..1510230 (+) | 204 | WP_016187270.1 | hypothetical protein | - |
| ACE4RJ_RS07485 | rinB | 1510223..1510396 (+) | 174 | WP_025176537.1 | transcriptional activator RinB | - |
| ACE4RJ_RS07490 | - | 1510397..1510543 (+) | 147 | WP_000989998.1 | hypothetical protein | - |
| ACE4RJ_RS07495 | - | 1510567..1510882 (+) | 316 | Protein_1471 | DUF1492 domain-containing protein | - |
| ACE4RJ_RS07500 | - | 1511210..1511704 (+) | 495 | WP_000594088.1 | terminase small subunit | - |
| ACE4RJ_RS07505 | - | 1511697..1512920 (+) | 1224 | WP_001037578.1 | PBSX family phage terminase large subunit | - |
| ACE4RJ_RS07510 | - | 1512917..1514341 (+) | 1425 | WP_016187272.1 | phage portal protein | - |
| ACE4RJ_RS07515 | - | 1514310..1515260 (+) | 951 | WP_000184140.1 | phage head morphogenesis protein | - |
| ACE4RJ_RS07520 | - | 1515264..1515497 (+) | 234 | WP_000440857.1 | hypothetical protein | - |
| ACE4RJ_RS07525 | - | 1515601..1516185 (+) | 585 | WP_016187273.1 | DUF4355 domain-containing protein | - |
| ACE4RJ_RS07530 | - | 1516202..1517116 (+) | 915 | WP_016187274.1 | phage major capsid protein | - |
| ACE4RJ_RS07535 | - | 1517128..1517271 (+) | 144 | WP_000002930.1 | hypothetical protein | - |
| ACE4RJ_RS07540 | - | 1517277..1517627 (+) | 351 | WP_016187275.1 | hypothetical protein | - |
| ACE4RJ_RS07545 | - | 1517639..1517974 (+) | 336 | WP_021285837.1 | phage head closure protein | - |
| ACE4RJ_RS07550 | - | 1517961..1518368 (+) | 408 | WP_021285836.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACE4RJ_RS07555 | - | 1518381..1518806 (+) | 426 | WP_016187278.1 | DUF3168 domain-containing protein | - |
| ACE4RJ_RS07560 | - | 1518807..1519364 (+) | 558 | WP_000057585.1 | hypothetical protein | - |
| ACE4RJ_RS07565 | - | 1519431..1519943 (+) | 513 | WP_000134336.1 | tail assembly chaperone | - |
| ACE4RJ_RS07570 | - | 1520123..1520272 (+) | 150 | WP_016187279.1 | hypothetical protein | - |
| ACE4RJ_RS07575 | - | 1520276..1523161 (+) | 2886 | WP_021285835.1 | terminase | - |
| ACE4RJ_RS07580 | - | 1523176..1524117 (+) | 942 | WP_021285834.1 | phage tail domain-containing protein | - |
| ACE4RJ_RS07585 | - | 1524128..1526014 (+) | 1887 | WP_016187282.1 | SGNH/GDSL hydrolase family protein | - |
| ACE4RJ_RS07590 | - | 1526027..1527925 (+) | 1899 | WP_374749790.1 | hypothetical protein | - |
| ACE4RJ_RS07595 | - | 1527925..1529748 (+) | 1824 | WP_374749789.1 | BppU family phage baseplate upper protein | - |
| ACE4RJ_RS07600 | - | 1529748..1530125 (+) | 378 | WP_016187285.1 | DUF2977 domain-containing protein | - |
| ACE4RJ_RS07605 | - | 1530135..1530326 (+) | 192 | WP_374750106.1 | XkdX family protein | - |
| ACE4RJ_RS07610 | - | 1530350..1530649 (+) | 300 | WP_021285833.1 | DUF2951 family protein | - |
| ACE4RJ_RS07615 | - | 1530786..1532660 (+) | 1875 | WP_016187457.1 | glucosaminidase domain-containing protein | - |
| ACE4RJ_RS07620 | - | 1532673..1532900 (+) | 228 | Protein_1496 | BppU family phage baseplate upper protein | - |
| ACE4RJ_RS07625 | - | 1533143..1533397 (+) | 255 | WP_016187459.1 | phage holin | - |
| ACE4RJ_RS07630 | - | 1533409..1534164 (+) | 756 | WP_016187460.1 | CHAP domain-containing protein | - |
| ACE4RJ_RS07635 | - | 1534808..1534987 (+) | 180 | WP_000201920.1 | hypothetical protein | - |
| ACE4RJ_RS07640 | - | 1535009..1535535 (+) | 527 | Protein_1500 | Panacea domain-containing protein | - |
| ACE4RJ_RS07645 | - | 1535525..1535923 (+) | 399 | WP_000557464.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16066.57 Da Isoelectric Point: 5.8724
>NTDB_id=1165246 ACE4RJ_RS07380 WP_016187439.1 1502203..1502631(+) (ssbA) [Staphylococcus aureus isolate H3_23S01314-1]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1165246 ACE4RJ_RS07380 WP_016187439.1 1502203..1502631(+) (ssbA) [Staphylococcus aureus isolate H3_23S01314-1]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.62 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |