Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACE4RG_RS12225 | Genome accession | NZ_OZ059819 |
| Coordinates | 2467151..2467579 (-) | Length | 142 a.a. |
| NCBI ID | WP_016187439.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate H2_22S00635-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2433860..2476452 | 2467151..2467579 | within | 0 |
Gene organization within MGE regions
Location: 2433860..2476452
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACE4RG_RS11960 | - | 2433860..2434258 (-) | 399 | WP_000557464.1 | hypothetical protein | - |
| ACE4RG_RS11965 | - | 2434248..2434774 (-) | 527 | Protein_2327 | Panacea domain-containing protein | - |
| ACE4RG_RS11970 | - | 2434796..2434975 (-) | 180 | WP_000201920.1 | hypothetical protein | - |
| ACE4RG_RS11975 | - | 2435619..2436374 (-) | 756 | WP_016187460.1 | CHAP domain-containing protein | - |
| ACE4RG_RS11980 | - | 2436386..2436640 (-) | 255 | WP_016187459.1 | phage holin | - |
| ACE4RG_RS11985 | - | 2436883..2437110 (-) | 228 | Protein_2331 | BppU family phage baseplate upper protein | - |
| ACE4RG_RS11990 | - | 2437123..2438997 (-) | 1875 | WP_016187457.1 | glucosaminidase domain-containing protein | - |
| ACE4RG_RS11995 | - | 2439134..2439433 (-) | 300 | WP_021285833.1 | DUF2951 family protein | - |
| ACE4RG_RS12000 | - | 2439474..2439647 (-) | 174 | WP_001800921.1 | XkdX family protein | - |
| ACE4RG_RS12005 | - | 2439657..2440034 (-) | 378 | WP_016187285.1 | DUF2977 domain-containing protein | - |
| ACE4RG_RS12010 | - | 2440034..2441857 (-) | 1824 | WP_374749789.1 | BppU family phage baseplate upper protein | - |
| ACE4RG_RS12015 | - | 2441857..2443755 (-) | 1899 | WP_374749790.1 | hypothetical protein | - |
| ACE4RG_RS12020 | - | 2443768..2445654 (-) | 1887 | WP_016187282.1 | SGNH/GDSL hydrolase family protein | - |
| ACE4RG_RS12025 | - | 2445665..2446606 (-) | 942 | WP_021285834.1 | phage tail domain-containing protein | - |
| ACE4RG_RS12030 | - | 2446621..2449506 (-) | 2886 | WP_021285835.1 | terminase | - |
| ACE4RG_RS12035 | - | 2449510..2449659 (-) | 150 | WP_016187279.1 | hypothetical protein | - |
| ACE4RG_RS12040 | - | 2449839..2450351 (-) | 513 | WP_000134336.1 | tail assembly chaperone | - |
| ACE4RG_RS12045 | - | 2450418..2450975 (-) | 558 | WP_000057585.1 | hypothetical protein | - |
| ACE4RG_RS12050 | - | 2450976..2451401 (-) | 426 | WP_016187278.1 | DUF3168 domain-containing protein | - |
| ACE4RG_RS12055 | - | 2451414..2451821 (-) | 408 | WP_021285836.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACE4RG_RS12060 | - | 2451808..2452143 (-) | 336 | WP_021285837.1 | phage head closure protein | - |
| ACE4RG_RS12065 | - | 2452155..2452505 (-) | 351 | WP_016187275.1 | hypothetical protein | - |
| ACE4RG_RS12070 | - | 2452511..2452654 (-) | 144 | WP_000002930.1 | hypothetical protein | - |
| ACE4RG_RS12075 | - | 2452666..2453580 (-) | 915 | WP_016187274.1 | phage major capsid protein | - |
| ACE4RG_RS12080 | - | 2453597..2454181 (-) | 585 | WP_016187273.1 | DUF4355 domain-containing protein | - |
| ACE4RG_RS12085 | - | 2454285..2454518 (-) | 234 | WP_000440857.1 | hypothetical protein | - |
| ACE4RG_RS12090 | - | 2454522..2455472 (-) | 951 | WP_000184140.1 | phage head morphogenesis protein | - |
| ACE4RG_RS12095 | - | 2455441..2456865 (-) | 1425 | WP_016187272.1 | phage portal protein | - |
| ACE4RG_RS12100 | - | 2456862..2458085 (-) | 1224 | WP_001037578.1 | PBSX family phage terminase large subunit | - |
| ACE4RG_RS12105 | - | 2458078..2458572 (-) | 495 | WP_000594088.1 | terminase small subunit | - |
| ACE4RG_RS12110 | - | 2458900..2459215 (-) | 316 | Protein_2356 | DUF1492 domain-containing protein | - |
| ACE4RG_RS12115 | - | 2459239..2459385 (-) | 147 | WP_000989998.1 | hypothetical protein | - |
| ACE4RG_RS12120 | rinB | 2459386..2459559 (-) | 174 | WP_025176537.1 | transcriptional activator RinB | - |
| ACE4RG_RS12125 | - | 2459552..2459755 (-) | 204 | WP_016187270.1 | hypothetical protein | - |
| ACE4RG_RS12130 | - | 2459752..2459958 (-) | 207 | WP_000195770.1 | DUF1381 domain-containing protein | - |
| ACE4RG_RS12135 | - | 2459995..2460531 (-) | 537 | WP_000185693.1 | dUTPase | - |
| ACE4RG_RS12140 | - | 2460524..2460772 (-) | 249 | WP_025176536.1 | DUF1024 family protein | - |
| ACE4RG_RS12145 | - | 2460749..2461135 (-) | 387 | Protein_2363 | acetyltransferase | - |
| ACE4RG_RS12150 | - | 2461135..2461326 (-) | 192 | WP_021285959.1 | hypothetical protein | - |
| ACE4RG_RS12155 | - | 2461323..2461729 (-) | 407 | Protein_2365 | hypothetical protein | - |
| ACE4RG_RS12160 | - | 2461726..2461938 (-) | 213 | WP_000695732.1 | hypothetical protein | - |
| ACE4RG_RS12165 | - | 2461952..2462641 (-) | 690 | WP_000097190.1 | N-6 DNA methylase | - |
| ACE4RG_RS12170 | - | 2462638..2462838 (-) | 201 | WP_000224767.1 | hypothetical protein | - |
| ACE4RG_RS12175 | - | 2462841..2463098 (-) | 258 | WP_021285960.1 | DUF3310 domain-containing protein | - |
| ACE4RG_RS12180 | - | 2463098..2463457 (-) | 360 | WP_016187441.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACE4RG_RS12185 | - | 2463585..2463890 (-) | 306 | WP_000101252.1 | hypothetical protein | - |
| ACE4RG_RS12190 | - | 2463891..2464076 (-) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| ACE4RG_RS12195 | - | 2464081..2464485 (-) | 405 | WP_000049794.1 | DUF1064 domain-containing protein | - |
| ACE4RG_RS12200 | - | 2464495..2464716 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| ACE4RG_RS12205 | - | 2464729..2464890 (-) | 162 | WP_000237154.1 | hypothetical protein | - |
| ACE4RG_RS12210 | - | 2464884..2465657 (-) | 774 | WP_021285961.1 | ATP-binding protein | - |
| ACE4RG_RS12215 | - | 2465667..2466470 (-) | 804 | WP_000504986.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACE4RG_RS12220 | - | 2466442..2467137 (-) | 696 | WP_015980404.1 | putative HNHc nuclease | - |
| ACE4RG_RS12225 | ssbA | 2467151..2467579 (-) | 429 | WP_016187439.1 | single-stranded DNA-binding protein | Machinery gene |
| ACE4RG_RS12230 | - | 2467579..2468217 (-) | 639 | WP_001043063.1 | ERF family protein | - |
| ACE4RG_RS12235 | - | 2468217..2468696 (-) | 480 | WP_016187438.1 | siphovirus Gp157 family protein | - |
| ACE4RG_RS12240 | - | 2468711..2468971 (-) | 261 | WP_021285962.1 | DUF1108 family protein | - |
| ACE4RG_RS12245 | - | 2468976..2469278 (-) | 303 | WP_000163429.1 | DUF2482 family protein | - |
| ACE4RG_RS12250 | - | 2469381..2469542 (-) | 162 | WP_000048124.1 | DUF1270 family protein | - |
| ACE4RG_RS12255 | - | 2469535..2469756 (-) | 222 | WP_000977381.1 | hypothetical protein | - |
| ACE4RG_RS12260 | - | 2469827..2470072 (+) | 246 | WP_016187267.1 | hypothetical protein | - |
| ACE4RG_RS12265 | - | 2470040..2470243 (-) | 204 | Protein_2387 | hypothetical protein | - |
| ACE4RG_RS12270 | - | 2470268..2471008 (-) | 741 | WP_001576117.1 | phage antirepressor KilAC domain-containing protein | - |
| ACE4RG_RS12275 | - | 2471073..2471309 (+) | 237 | WP_021285963.1 | hypothetical protein | - |
| ACE4RG_RS12280 | - | 2471302..2471463 (-) | 162 | WP_001153175.1 | hypothetical protein | - |
| ACE4RG_RS12285 | - | 2471478..2471717 (-) | 240 | WP_016187264.1 | helix-turn-helix transcriptional regulator | - |
| ACE4RG_RS12290 | - | 2471909..2472583 (+) | 675 | WP_000142628.1 | XRE family transcriptional regulator | - |
| ACE4RG_RS12295 | - | 2472635..2473618 (+) | 984 | WP_021285964.1 | glycosyltransferase family 2 protein | - |
| ACE4RG_RS12300 | - | 2473629..2473871 (+) | 243 | WP_016187262.1 | hypothetical protein | - |
| ACE4RG_RS12305 | - | 2473938..2474987 (+) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| ACE4RG_RS12310 | sufB | 2475055..2476452 (-) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16066.57 Da Isoelectric Point: 5.8724
>NTDB_id=1165186 ACE4RG_RS12225 WP_016187439.1 2467151..2467579(-) (ssbA) [Staphylococcus aureus isolate H2_22S00635-1]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1165186 ACE4RG_RS12225 WP_016187439.1 2467151..2467579(-) (ssbA) [Staphylococcus aureus isolate H2_22S00635-1]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.62 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |