Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QOR52_RS01200 | Genome accession | NZ_OX460943 |
| Coordinates | 199360..199755 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282447.1 | Uniprot ID | A0AAV3JLT6 |
| Organism | Streptococcus agalactiae isolate MRI Z2-328 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 190965..241523 | 199360..199755 | within | 0 |
Gene organization within MGE regions
Location: 190965..241523
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOR52_RS01140 | - | 191756..192949 (+) | 1194 | WP_000047534.1 | acetate kinase | - |
| QOR52_RS01145 | - | 193101..193307 (+) | 207 | WP_000798241.1 | helix-turn-helix transcriptional regulator | - |
| QOR52_RS01150 | - | 193366..193503 (+) | 138 | WP_001865900.1 | hypothetical protein | - |
| QOR52_RS01155 | - | 193544..193999 (+) | 456 | WP_000905673.1 | hypothetical protein | - |
| QOR52_RS01160 | - | 194068..194733 (+) | 666 | WP_000008113.1 | type II CAAX endopeptidase family protein | - |
| QOR52_RS01165 | proC | 194754..195524 (-) | 771 | WP_001865901.1 | pyrroline-5-carboxylate reductase | - |
| QOR52_RS01170 | pepA | 195594..196661 (-) | 1068 | WP_001281323.1 | glutamyl aminopeptidase | - |
| QOR52_RS01175 | - | 196846..197085 (-) | 240 | WP_000660180.1 | hypothetical protein | - |
| QOR52_RS01180 | - | 197246..197530 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| QOR52_RS01185 | - | 197527..197850 (+) | 324 | WP_000602781.1 | thioredoxin family protein | - |
| QOR52_RS01190 | ytpR | 197883..198509 (+) | 627 | WP_000578328.1 | YtpR family tRNA-binding protein | - |
| QOR52_RS01195 | - | 198563..199279 (-) | 717 | WP_000186185.1 | class I SAM-dependent methyltransferase | - |
| QOR52_RS01200 | ssbA | 199360..199755 (+) | 396 | WP_000282447.1 | single-stranded DNA-binding protein | Machinery gene |
| QOR52_RS01205 | - | 199879..200523 (+) | 645 | WP_000416612.1 | HAD family hydrolase | - |
| QOR52_RS01210 | - | 200550..202295 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| QOR52_RS01215 | - | 202276..203016 (+) | 741 | WP_000697630.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | - |
| QOR52_RS01220 | - | 203186..203641 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| QOR52_RS01225 | lrgB | 203643..204371 (+) | 729 | WP_000421726.1 | antiholin-like protein LrgB | - |
| QOR52_RS01230 | - | 204614..206242 (+) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| QOR52_RS01235 | - | 206355..207332 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| QOR52_RS01240 | - | 207329..208150 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| QOR52_RS01245 | - | 208162..208965 (+) | 804 | WP_000140984.1 | ABC transporter ATP-binding protein | - |
| QOR52_RS01250 | - | 208949..209575 (+) | 627 | WP_000171311.1 | ABC transporter ATP-binding protein | - |
| QOR52_RS01255 | treP | 209858..211888 (+) | 2031 | WP_000434616.1 | PTS system trehalose-specific EIIBC component | - |
| QOR52_RS01260 | treC | 212110..213735 (+) | 1626 | WP_000151017.1 | alpha,alpha-phosphotrehalase | - |
| QOR52_RS01265 | - | 213951..215987 (+) | 2037 | WP_283572336.1 | BglG family transcription antiterminator | - |
| QOR52_RS01270 | - | 215990..216274 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| QOR52_RS01275 | - | 216287..217642 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| QOR52_RS01280 | - | 217645..218502 (+) | 858 | WP_000203489.1 | transketolase | - |
| QOR52_RS01285 | - | 218499..219428 (+) | 930 | WP_001203821.1 | transketolase C-terminal domain-containing protein | - |
| QOR52_RS01290 | - | 219537..220796 (+) | 1260 | WP_001203071.1 | ferric reductase-like transmembrane domain-containing protein | - |
| QOR52_RS01295 | rpsO | 220884..221153 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| QOR52_RS01300 | pnp | 221534..223663 (+) | 2130 | WP_000043850.1 | polyribonucleotide nucleotidyltransferase | - |
| QOR52_RS01305 | - | 223665..224417 (+) | 753 | WP_000204782.1 | SseB family protein | - |
| QOR52_RS01310 | cysE | 224426..225010 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| QOR52_RS01315 | - | 225020..225202 (+) | 183 | WP_000656476.1 | lipoprotein | - |
| QOR52_RS01320 | cysS | 225199..226542 (+) | 1344 | WP_000591125.1 | cysteine--tRNA ligase | - |
| QOR52_RS01325 | - | 226535..226921 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| QOR52_RS01330 | rlmB | 227024..227779 (+) | 756 | WP_000178026.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| QOR52_RS01335 | - | 227776..228294 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| QOR52_RS01340 | - | 228387..229247 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| QOR52_RS01345 | - | 229784..229903 (+) | 120 | Protein_209 | helix-turn-helix domain-containing protein | - |
| QOR52_RS01350 | rplM | 230128..230574 (+) | 447 | WP_001865567.1 | 50S ribosomal protein L13 | - |
| QOR52_RS01355 | rpsI | 230595..230987 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| QOR52_RS01360 | - | 231115..232269 (-) | 1155 | WP_017646005.1 | site-specific integrase | - |
| QOR52_RS01365 | - | 232333..232923 (-) | 591 | WP_000181098.1 | helix-turn-helix transcriptional regulator | - |
| QOR52_RS01370 | - | 233078..233383 (+) | 306 | WP_000331954.1 | hypothetical protein | - |
| QOR52_RS01375 | - | 233519..233797 (+) | 279 | WP_000134670.1 | hypothetical protein | - |
| QOR52_RS01380 | - | 233808..234038 (+) | 231 | WP_000360142.1 | hypothetical protein | - |
| QOR52_RS01385 | - | 234051..234377 (+) | 327 | WP_000384270.1 | replication initiator protein A | - |
| QOR52_RS01390 | - | 234381..235010 (+) | 630 | WP_000591148.1 | hypothetical protein | - |
| QOR52_RS01395 | - | 235323..236198 (+) | 876 | WP_000770113.1 | hypothetical protein | - |
| QOR52_RS01400 | - | 236234..236668 (+) | 435 | WP_001220479.1 | hypothetical protein | - |
| QOR52_RS01405 | mobV | 236984..238240 (+) | 1257 | WP_000122832.1 | MobV family relaxase | - |
| QOR52_RS01410 | - | 238408..238878 (+) | 471 | WP_000130119.1 | hypothetical protein | - |
| QOR52_RS01415 | - | 239183..239518 (-) | 336 | WP_000384858.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QOR52_RS01420 | - | 239508..239795 (-) | 288 | WP_000255538.1 | hypothetical protein | - |
| QOR52_RS01425 | - | 240198..241418 (-) | 1221 | WP_000156558.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14774.80 Da Isoelectric Point: 7.0189
>NTDB_id=1159229 QOR52_RS01200 WP_000282447.1 199360..199755(+) (ssbA) [Streptococcus agalactiae isolate MRI Z2-328]
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=1159229 QOR52_RS01200 WP_000282447.1 199360..199755(+) (ssbA) [Streptococcus agalactiae isolate MRI Z2-328]
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
80.916 |
100 |
0.809 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis SK321 |
76.336 |
100 |
0.763 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
60.526 |
87.023 |
0.527 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.018 |
86.26 |
0.397 |