Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QOR48_RS01175 | Genome accession | NZ_OX460942 |
| Coordinates | 199163..199558 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282450.1 | Uniprot ID | A0AAW6XW90 |
| Organism | Streptococcus agalactiae isolate MRI Z2-158 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 190265..235946 | 199163..199558 | within | 0 |
Gene organization within MGE regions
Location: 190265..235946
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOR48_RS01110 | comYH | 190554..191528 (+) | 975 | WP_001008570.1 | class I SAM-dependent methyltransferase | Machinery gene |
| QOR48_RS01115 | - | 191560..192753 (+) | 1194 | WP_000047535.1 | acetate kinase | - |
| QOR48_RS01120 | - | 192904..193110 (+) | 207 | WP_000798242.1 | helix-turn-helix transcriptional regulator | - |
| QOR48_RS01125 | - | 193169..193306 (+) | 138 | WP_001867090.1 | hypothetical protein | - |
| QOR48_RS01130 | - | 193347..193802 (+) | 456 | WP_000905674.1 | hypothetical protein | - |
| QOR48_RS01135 | - | 193871..194536 (+) | 666 | WP_000008111.1 | type II CAAX endopeptidase family protein | - |
| QOR48_RS01140 | proC | 194557..195327 (-) | 771 | WP_001867096.1 | pyrroline-5-carboxylate reductase | - |
| QOR48_RS01145 | pepA | 195397..196464 (-) | 1068 | WP_001281321.1 | glutamyl aminopeptidase | - |
| QOR48_RS01150 | - | 196649..196888 (-) | 240 | WP_000660181.1 | hypothetical protein | - |
| QOR48_RS01155 | - | 197049..197333 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| QOR48_RS01160 | - | 197330..197653 (+) | 324 | WP_000601792.1 | thioredoxin family protein | - |
| QOR48_RS01165 | ytpR | 197686..198312 (+) | 627 | WP_000578331.1 | YtpR family tRNA-binding protein | - |
| QOR48_RS01170 | - | 198366..199082 (-) | 717 | WP_000186183.1 | class I SAM-dependent methyltransferase | - |
| QOR48_RS01175 | ssbA | 199163..199558 (+) | 396 | WP_000282450.1 | single-stranded DNA-binding protein | Machinery gene |
| QOR48_RS01180 | - | 199681..200325 (+) | 645 | WP_000416612.1 | HAD family hydrolase | - |
| QOR48_RS01185 | - | 200352..202097 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| QOR48_RS01190 | - | 202078..202818 (+) | 741 | WP_000697630.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | - |
| QOR48_RS01195 | - | 202988..203443 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| QOR48_RS01200 | lrgB | 203445..204173 (+) | 729 | WP_000421727.1 | antiholin-like protein LrgB | - |
| QOR48_RS01205 | - | 204416..206044 (+) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| QOR48_RS01210 | - | 206157..207134 (+) | 978 | WP_000680644.1 | ABC transporter permease | - |
| QOR48_RS01215 | - | 207131..207952 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| QOR48_RS01220 | - | 207964..208767 (+) | 804 | WP_000140979.1 | ABC transporter ATP-binding protein | - |
| QOR48_RS01225 | - | 208751..209377 (+) | 627 | WP_283573022.1 | ABC transporter ATP-binding protein | - |
| QOR48_RS01230 | treP | 209659..211689 (+) | 2031 | WP_000434610.1 | PTS system trehalose-specific EIIBC component | - |
| QOR48_RS01235 | treC | 211911..213536 (+) | 1626 | WP_000151014.1 | alpha,alpha-phosphotrehalase | - |
| QOR48_RS01240 | - | 213756..215792 (+) | 2037 | WP_000228178.1 | BglG family transcription antiterminator | - |
| QOR48_RS01245 | - | 215795..216079 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| QOR48_RS01250 | - | 216092..217447 (+) | 1356 | WP_000677353.1 | PTS ascorbate transporter subunit IIC | - |
| QOR48_RS01255 | - | 217450..218307 (+) | 858 | WP_000203492.1 | transketolase | - |
| QOR48_RS01260 | - | 218304..219233 (+) | 930 | WP_001203828.1 | transketolase C-terminal domain-containing protein | - |
| QOR48_RS01265 | - | 219342..220601 (+) | 1260 | WP_001203074.1 | ferric reductase-like transmembrane domain-containing protein | - |
| QOR48_RS01270 | rpsO | 220689..220958 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| QOR48_RS01275 | pnp | 221340..223469 (+) | 2130 | WP_000043857.1 | polyribonucleotide nucleotidyltransferase | - |
| QOR48_RS01280 | - | 223471..224223 (+) | 753 | WP_000204780.1 | SseB family protein | - |
| QOR48_RS01285 | cysE | 224232..224816 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| QOR48_RS01290 | - | 224826..225008 (+) | 183 | WP_000656477.1 | hypothetical protein | - |
| QOR48_RS01295 | cysS | 225005..226348 (+) | 1344 | WP_000591129.1 | cysteine--tRNA ligase | - |
| QOR48_RS01300 | - | 226341..226727 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| QOR48_RS01305 | rlmB | 226830..227585 (+) | 756 | WP_000178019.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| QOR48_RS01310 | - | 227582..228100 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| QOR48_RS01315 | - | 228193..229053 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| QOR48_RS01320 | - | 229591..229710 (+) | 120 | Protein_207 | helix-turn-helix domain-containing protein | - |
| QOR48_RS01325 | - | 230028..231194 (-) | 1167 | WP_000160598.1 | IS30-like element ISSag9 family transposase | - |
| QOR48_RS01330 | rplM | 231495..231941 (+) | 447 | WP_001867156.1 | 50S ribosomal protein L13 | - |
| QOR48_RS01335 | rpsI | 231962..232354 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| QOR48_RS01340 | - | 232500..233654 (-) | 1155 | WP_000110711.1 | site-specific integrase | - |
| QOR48_RS01345 | - | 233709..234227 (-) | 519 | WP_000181342.1 | helix-turn-helix transcriptional regulator | - |
| QOR48_RS01350 | - | 234374..234658 (+) | 285 | WP_001287945.1 | hypothetical protein | - |
| QOR48_RS01355 | - | 234670..235524 (+) | 855 | WP_000005759.1 | phage replisome organizer N-terminal domain-containing protein | - |
| QOR48_RS01360 | - | 235535..235825 (+) | 291 | WP_000158581.1 | DUF5962 family protein | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14790.80 Da Isoelectric Point: 7.0189
>NTDB_id=1159176 QOR48_RS01175 WP_000282450.1 199163..199558(+) (ssbA) [Streptococcus agalactiae isolate MRI Z2-158]
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISVDGELRTR
KYEKDGQTHYITEVLASSFQLLESRSQRAMRENNISGDLSDLVLEEEELPF
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISVDGELRTR
KYEKDGQTHYITEVLASSFQLLESRSQRAMRENNISGDLSDLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=1159176 QOR48_RS01175 WP_000282450.1 199163..199558(+) (ssbA) [Streptococcus agalactiae isolate MRI Z2-158]
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTAAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAGTAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTTCCCA
ACGTGCTATGCGTGAAAATAACATTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTAAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAGTAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTTCCCA
ACGTGCTATGCGTGAAAATAACATTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
80.153 |
100 |
0.802 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis SK321 |
76.336 |
100 |
0.763 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
59.649 |
87.023 |
0.519 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.402 |
81.679 |
0.42 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.903 |
86.26 |
0.405 |