Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DQL83_RS04735 | Genome accession | NZ_LS483311 |
| Coordinates | 901854..902282 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain NCTC6136 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 892851..937013 | 901854..902282 | within | 0 |
Gene organization within MGE regions
Location: 892851..937013
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL83_RS04655 (NCTC6136_00861) | sufB | 892851..894248 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| DQL83_RS04660 (NCTC6136_00862) | - | 894316..895365 (-) | 1050 | WP_031836904.1 | tyrosine-type recombinase/integrase | - |
| DQL83_RS04665 (NCTC6136_00863) | - | 895478..895678 (+) | 201 | WP_000143212.1 | excisionase | - |
| DQL83_RS04670 (NCTC6136_00864) | - | 895615..896520 (-) | 906 | WP_000391592.1 | hypothetical protein | - |
| DQL83_RS04675 (NCTC6136_00865) | - | 896552..897277 (-) | 726 | WP_031836905.1 | PH domain-containing protein | - |
| DQL83_RS04680 (NCTC6136_00866) | - | 897305..897979 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL83_RS04685 (NCTC6136_00867) | - | 897996..898328 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| DQL83_RS04690 (NCTC6136_00868) | - | 898591..898785 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| DQL83_RS04695 (NCTC6136_00869) | - | 898785..899552 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| DQL83_RS04700 (NCTC6136_00870) | tscA | 899553..899777 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| DQL83_RS04705 (NCTC6136_00871) | - | 899817..900266 (+) | 450 | WP_001094943.1 | hypothetical protein | - |
| DQL83_RS04710 (NCTC6136_00872) | - | 900280..900501 (+) | 222 | WP_000977378.1 | hypothetical protein | - |
| DQL83_RS04715 (NCTC6136_00873) | - | 900494..900655 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| DQL83_RS04720 (NCTC6136_00874) | - | 900747..901007 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| DQL83_RS04725 (NCTC6136_00875) | - | 901017..901238 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| DQL83_RS04730 (NCTC6136_00876) | - | 901231..901854 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| DQL83_RS04735 (NCTC6136_00877) | ssbA | 901854..902282 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL83_RS04740 (NCTC6136_00878) | - | 902296..902970 (+) | 675 | WP_031836907.1 | putative HNHc nuclease | - |
| DQL83_RS15075 (NCTC6136_00879) | - | 902967..903116 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| DQL83_RS04745 (NCTC6136_00880) | - | 903109..903390 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| DQL83_RS04750 (NCTC6136_00881) | - | 903456..904226 (+) | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
| DQL83_RS04755 (NCTC6136_00882) | - | 904236..905015 (+) | 780 | WP_031836908.1 | ATP-binding protein | - |
| DQL83_RS04760 (NCTC6136_00883) | - | 905009..905167 (+) | 159 | WP_031836909.1 | hypothetical protein | - |
| DQL83_RS04765 (NCTC6136_00884) | - | 905180..905401 (+) | 222 | WP_001123674.1 | DUF3269 family protein | - |
| DQL83_RS04770 (NCTC6136_00885) | - | 905411..905818 (+) | 408 | WP_031836910.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQL83_RS04775 (NCTC6136_00886) | - | 905818..906003 (+) | 186 | WP_031836911.1 | DUF3113 family protein | - |
| DQL83_RS04780 (NCTC6136_00887) | - | 906004..906366 (+) | 363 | WP_000536051.1 | SA1788 family PVL leukocidin-associated protein | - |
| DQL83_RS04785 (NCTC6136_00888) | - | 906366..906620 (+) | 255 | WP_000022736.1 | DUF3310 domain-containing protein | - |
| DQL83_RS04790 (NCTC6136_00889) | - | 906620..906868 (+) | 249 | WP_060474161.1 | SAV1978 family virulence-associated passenger protein | - |
| DQL83_RS04795 (NCTC6136_00890) | - | 906882..907088 (+) | 207 | WP_000693989.1 | hypothetical protein | - |
| DQL83_RS04800 (NCTC6136_00891) | - | 907091..907495 (+) | 405 | WP_031836912.1 | hypothetical protein | - |
| DQL83_RS04805 (NCTC6136_00892) | - | 907492..907686 (+) | 195 | WP_000983953.1 | hypothetical protein | - |
| DQL83_RS04810 (NCTC6136_00893) | - | 907683..908135 (+) | 453 | WP_000982706.1 | YopX family protein | - |
| DQL83_RS04815 (NCTC6136_00894) | - | 908132..908635 (+) | 504 | WP_031928724.1 | hypothetical protein | - |
| DQL83_RS04820 (NCTC6136_00895) | - | 908638..908835 (+) | 198 | WP_094321643.1 | hypothetical protein | - |
| DQL83_RS04825 (NCTC6136_00896) | - | 908828..909076 (+) | 249 | WP_031836882.1 | DUF1024 family protein | - |
| DQL83_RS04830 (NCTC6136_00897) | - | 909069..909602 (+) | 534 | WP_031836883.1 | dUTP diphosphatase | - |
| DQL83_RS04835 (NCTC6136_00898) | - | 909639..909923 (+) | 285 | WP_223289268.1 | hypothetical protein | - |
| DQL83_RS04840 (NCTC6136_00899) | - | 909972..910496 (+) | 525 | WP_031836885.1 | hypothetical protein | - |
| DQL83_RS04845 (NCTC6136_00900) | rinB | 910543..910716 (+) | 174 | WP_000595259.1 | transcriptional activator RinB | - |
| DQL83_RS04850 (NCTC6136_00901) | - | 910717..911118 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| DQL83_RS04855 (NCTC6136_00902) | - | 911471..911965 (+) | 495 | WP_000594088.1 | terminase small subunit | - |
| DQL83_RS04860 (NCTC6136_00903) | - | 911958..913181 (+) | 1224 | WP_001037585.1 | PBSX family phage terminase large subunit | - |
| DQL83_RS04865 (NCTC6136_00904) | - | 913178..914602 (+) | 1425 | WP_000177426.1 | phage portal protein | - |
| DQL83_RS04870 (NCTC6136_00905) | - | 914571..915521 (+) | 951 | WP_000184132.1 | phage head morphogenesis protein | - |
| DQL83_RS04875 (NCTC6136_00906) | - | 915617..916201 (+) | 585 | WP_001019219.1 | DUF4355 domain-containing protein | - |
| DQL83_RS04880 (NCTC6136_00907) | - | 916218..917132 (+) | 915 | WP_000235168.1 | phage major capsid protein | - |
| DQL83_RS15080 (NCTC6136_00908) | - | 917144..917287 (+) | 144 | WP_000002931.1 | hypothetical protein | - |
| DQL83_RS04885 (NCTC6136_00909) | - | 917293..917643 (+) | 351 | WP_000177348.1 | phage head-tail adapter protein | - |
| DQL83_RS04890 (NCTC6136_00910) | - | 917655..917990 (+) | 336 | WP_000483041.1 | phage head closure protein | - |
| DQL83_RS04895 (NCTC6136_00911) | - | 917977..918384 (+) | 408 | WP_001151323.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL83_RS04900 (NCTC6136_00912) | - | 918397..918822 (+) | 426 | WP_000270190.1 | DUF3168 domain-containing protein | - |
| DQL83_RS04905 (NCTC6136_00913) | - | 918823..919380 (+) | 558 | WP_000057583.1 | hypothetical protein | - |
| DQL83_RS04910 (NCTC6136_00914) | - | 919447..919953 (+) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| DQL83_RS15085 (NCTC6136_00915) | - | 920133..920282 (+) | 150 | WP_000617400.1 | hypothetical protein | - |
| DQL83_RS04915 (NCTC6136_00916) | - | 920286..923171 (+) | 2886 | WP_000379446.1 | hypothetical protein | - |
| DQL83_RS04920 (NCTC6136_00917) | - | 923186..924127 (+) | 942 | WP_000560181.1 | phage tail domain-containing protein | - |
| DQL83_RS04925 (NCTC6136_00918) | - | 924138..926024 (+) | 1887 | WP_029549389.1 | SGNH/GDSL hydrolase family protein | - |
| DQL83_RS04930 (NCTC6136_00919) | - | 926037..927935 (+) | 1899 | WP_000323240.1 | hypothetical protein | - |
| DQL83_RS04935 (NCTC6136_00920) | - | 927935..929758 (+) | 1824 | WP_000259635.1 | phage baseplate upper protein | - |
| DQL83_RS04940 (NCTC6136_00921) | - | 929758..930135 (+) | 378 | WP_000705915.1 | DUF2977 domain-containing protein | - |
| DQL83_RS04945 (NCTC6136_00922) | - | 930139..930312 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| DQL83_RS04950 (NCTC6136_00923) | - | 930353..930652 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| DQL83_RS04955 (NCTC6136_00924) | - | 930789..932663 (+) | 1875 | WP_000524050.1 | glucosaminidase domain-containing protein | - |
| DQL83_RS04960 (NCTC6136_00925) | - | 932676..933914 (+) | 1239 | WP_000276657.1 | BppU family phage baseplate upper protein | - |
| DQL83_RS04965 (NCTC6136_00926) | - | 933920..934315 (+) | 396 | WP_000398858.1 | hypothetical protein | - |
| DQL83_RS04970 (NCTC6136_00927) | - | 934371..934646 (+) | 276 | WP_000351119.1 | phage holin | - |
| DQL83_RS04975 (NCTC6136_00928) | - | 934633..936045 (+) | 1413 | WP_111724406.1 | N-acetylmuramoyl-L-alanine amidase | - |
| DQL83_RS04980 (NCTC6136_00929) | eta | 936171..937013 (+) | 843 | WP_001065781.1 | exfoliative toxin A | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=1135896 DQL83_RS04735 WP_000934385.1 901854..902282(+) (ssbA) [Staphylococcus aureus strain NCTC6136]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1135896 DQL83_RS04735 WP_000934385.1 901854..902282(+) (ssbA) [Staphylococcus aureus strain NCTC6136]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |