Detailed information NTG1116819

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: EW030_RS07615
• Genome accession: NZ_LR130511
• Coordinates: 1532951..1533262 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain BPH2819 isolate BPH2819
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1527951..1538262

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EW030_RS07580	gcvPA	1528453..1529799 (-)	1347	WP_000019691.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
EW030_RS07585	gcvT	1529819..1530910 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
EW030_RS07590	-	1531069..1531593 (-)	525	WP_001015120.1	shikimate kinase	-
EW030_RS07595	-	1531583..1531729 (-)	147	WP_001792109.1	hypothetical protein	-
EW030_RS07600	comGF	1531826..1532323 (-)	498	WP_001788897.1	competence type IV pilus minor pilin ComGF	Machinery gene
EW030_RS07605	comGE	1532241..1532540 (-)	300	WP_000844410.1	hypothetical protein	Machinery gene
EW030_RS07610	comGD	1532527..1532973 (-)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
EW030_RS07615	comGC	1532951..1533262 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
EW030_RS07620	comGB	1533276..1534346 (-)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
EW030_RS07625	comGA	1534318..1535292 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
EW030_RS07630	-	1535344..1535967 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
EW030_RS07635	-	1535964..1536293 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
EW030_RS07640	-	1536293..1537279 (-)	987	WP_000161311.1	ROK family glucokinase	-
EW030_RS07645	-	1537276..1537479 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=1116819 EW030_RS07615 WP_000472256.1 1532951..1533262(-) (comGC) [Staphylococcus aureus strain BPH2819 isolate BPH2819]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1116819 EW030_RS07615 WP_000472256.1 1532951..1533262(-) (comGC) [Staphylococcus aureus strain BPH2819 isolate BPH2819]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369