Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SABB155_RS07725 | Genome accession | NZ_LN854556 |
| Coordinates | 1578691..1579002 (-) | Length | 103 a.a. |
| NCBI ID | WP_054190026.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BB155 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1573691..1584002
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SABB155_RS07690 (SABB155_14360) | gcvPA | 1574193..1575539 (-) | 1347 | WP_054190021.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SABB155_RS07695 (SABB155_14370) | gcvT | 1575559..1576650 (-) | 1092 | WP_054190022.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SABB155_RS07700 (SABB155_14380) | - | 1576809..1577333 (-) | 525 | WP_054190023.1 | shikimate kinase | - |
| SABB155_RS07705 | - | 1577323..1577469 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SABB155_RS07710 (SABB155_14390) | comGF | 1577566..1578063 (-) | 498 | WP_077446653.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SABB155_RS07715 (SABB155_14400) | comGE | 1577981..1578280 (-) | 300 | WP_054190024.1 | hypothetical protein | Machinery gene |
| SABB155_RS07720 (SABB155_14410) | comGD | 1578267..1578713 (-) | 447 | WP_077446655.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SABB155_RS07725 (SABB155_14420) | comGC | 1578691..1579002 (-) | 312 | WP_054190026.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SABB155_RS07730 (SABB155_14430) | comGB | 1579016..1580086 (-) | 1071 | WP_054190027.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SABB155_RS07735 (SABB155_14440) | comGA | 1580058..1581032 (-) | 975 | WP_054191886.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SABB155_RS07740 (SABB155_14450) | - | 1581084..1581707 (-) | 624 | WP_054190028.1 | MBL fold metallo-hydrolase | - |
| SABB155_RS07745 (SABB155_14460) | - | 1581704..1582033 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SABB155_RS07750 (SABB155_14470) | - | 1582033..1583019 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| SABB155_RS07755 (SAR1625) | - | 1583016..1583219 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11329.38 Da Isoelectric Point: 8.5268
>NTDB_id=1114661 SABB155_RS07725 WP_054190026.1 1578691..1579002(-) (comGC) [Staphylococcus aureus strain BB155]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIAEGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIAEGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1114661 SABB155_RS07725 WP_054190026.1 1578691..1579002(-) (comGC) [Staphylococcus aureus strain BB155]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGAGGGTTTCATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGAGGGTTTCATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus pneumoniae D39 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus pneumoniae R6 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus mitis SK321 |
50 |
83.495 |
0.417 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
50 |
83.495 |
0.417 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
42.857 |
88.35 |
0.379 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |