Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SRS_RS06640 | Genome accession | NZ_LN626917 |
| Coordinates | 1351491..1351919 (-) | Length | 142 a.a. |
| NCBI ID | WP_045178958.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1316616..1360289 | 1351491..1351919 | within | 0 |
Gene organization within MGE regions
Location: 1316616..1360289
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SRS_RS06375 | - | 1316616..1316801 (-) | 186 | WP_001286804.1 | hypothetical protein | - |
| SRS_RS06380 | - | 1316803..1316913 (-) | 111 | WP_031922866.1 | hypothetical protein | - |
| SRS_RS06385 | - | 1316984..1317136 (-) | 153 | WP_078103528.1 | hypothetical protein | - |
| SRS_RS06390 | - | 1317386..1318831 (-) | 1446 | WP_045178875.1 | SH3 domain-containing protein | - |
| SRS_RS06395 | - | 1318812..1319249 (-) | 438 | WP_045178878.1 | phage holin | - |
| SRS_RS06400 | - | 1319294..1319689 (-) | 396 | WP_045178881.1 | hypothetical protein | - |
| SRS_RS06405 | - | 1319694..1320932 (-) | 1239 | WP_045178883.1 | BppU family phage baseplate upper protein | - |
| SRS_RS06410 | - | 1320945..1322501 (-) | 1557 | Protein_1256 | N-acetylglucosaminidase | - |
| SRS_RS15825 | - | 1323024..1323380 (-) | 357 | WP_052671739.1 | hypothetical protein | - |
| SRS_RS06420 | - | 1323422..1323783 (-) | 362 | Protein_1258 | CHAP domain-containing protein | - |
| SRS_RS06425 | - | 1323920..1324219 (-) | 300 | WP_045178887.1 | DUF2951 domain-containing protein | - |
| SRS_RS06430 | - | 1324260..1324433 (-) | 174 | WP_001800921.1 | XkdX family protein | - |
| SRS_RS06435 | - | 1324437..1324814 (-) | 378 | WP_045178890.1 | DUF2977 domain-containing protein | - |
| SRS_RS06440 | - | 1324814..1326637 (-) | 1824 | WP_045178892.1 | phage baseplate upper protein | - |
| SRS_RS06445 | - | 1326637..1328547 (-) | 1911 | WP_045178895.1 | hypothetical protein | - |
| SRS_RS06450 | - | 1328562..1330463 (-) | 1902 | WP_045178903.1 | SGNH/GDSL hydrolase family protein | - |
| SRS_RS06455 | - | 1330472..1331419 (-) | 948 | WP_031792905.1 | phage tail family protein | - |
| SRS_RS06460 | - | 1331432..1334899 (-) | 3468 | WP_045178906.1 | membrane protein | - |
| SRS_RS06465 | - | 1334916..1335260 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| SRS_RS06470 | - | 1335290..1335655 (-) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| SRS_RS06475 | - | 1335717..1336298 (-) | 582 | WP_045178910.1 | phage major tail protein, TP901-1 family | - |
| SRS_RS06480 | - | 1336317..1336700 (-) | 384 | WP_000188649.1 | hypothetical protein | - |
| SRS_RS06485 | - | 1336712..1337059 (-) | 348 | WP_045178913.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SRS_RS06490 | - | 1337059..1337361 (-) | 303 | WP_045178916.1 | hypothetical protein | - |
| SRS_RS06495 | - | 1337358..1337690 (-) | 333 | WP_045178918.1 | phage head-tail connector protein | - |
| SRS_RS06500 | - | 1337699..1337986 (-) | 288 | WP_045178921.1 | hypothetical protein | - |
| SRS_RS06505 | - | 1338008..1338982 (-) | 975 | WP_045178923.1 | phage major capsid protein | - |
| SRS_RS06510 | - | 1338996..1339610 (-) | 615 | WP_045178926.1 | DUF4355 domain-containing protein | - |
| SRS_RS06515 | - | 1339745..1339915 (-) | 171 | WP_045178928.1 | hypothetical protein | - |
| SRS_RS06520 | - | 1339988..1340983 (-) | 996 | WP_045178931.1 | minor capsid protein | - |
| SRS_RS06525 | - | 1340990..1341406 (-) | 417 | Protein_1279 | phage portal protein | - |
| SRS_RS14705 | - | 1341636..1342265 (-) | 630 | WP_052671740.1 | hypothetical protein | - |
| SRS_RS06540 | - | 1342368..1343507 (-) | 1140 | Protein_1281 | phage portal protein | - |
| SRS_RS06545 | - | 1343518..1344795 (-) | 1278 | WP_000169945.1 | PBSX family phage terminase large subunit | - |
| SRS_RS06550 | - | 1344782..1345222 (-) | 441 | WP_045178932.1 | terminase small subunit | - |
| SRS_RS06555 | - | 1345409..1345828 (-) | 420 | WP_000058632.1 | transcriptional regulator | - |
| SRS_RS06560 | - | 1345843..1345989 (-) | 147 | WP_000989998.1 | hypothetical protein | - |
| SRS_RS06565 | rinB | 1345990..1346163 (-) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| SRS_RS06570 | - | 1346156..1346392 (-) | 237 | WP_045178936.1 | DUF7366 family protein | - |
| SRS_RS06575 | - | 1346385..1346588 (-) | 204 | WP_045178938.1 | hypothetical protein | - |
| SRS_RS06580 | - | 1346585..1346791 (-) | 207 | WP_045179693.1 | DUF1381 domain-containing protein | - |
| SRS_RS06585 | - | 1346808..1347068 (-) | 261 | WP_045178942.1 | hypothetical protein | - |
| SRS_RS06590 | - | 1347130..1347663 (-) | 534 | WP_045178572.1 | dUTP diphosphatase | - |
| SRS_RS06595 | - | 1347675..1347923 (-) | 249 | WP_045178944.1 | SAV1978 family virulence-associated passenger protein | - |
| SRS_RS06600 | - | 1347924..1348286 (-) | 363 | WP_045178946.1 | SA1788 family PVL leukocidin-associated protein | - |
| SRS_RS06605 | - | 1348287..1348472 (-) | 186 | WP_045178949.1 | DUF3113 family protein | - |
| SRS_RS06610 | - | 1348477..1348881 (-) | 405 | WP_000049798.1 | DUF1064 domain-containing protein | - |
| SRS_RS06615 | - | 1348892..1349113 (-) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| SRS_RS06620 | - | 1349126..1349284 (-) | 159 | WP_000628833.1 | hypothetical protein | - |
| SRS_RS06625 | - | 1349281..1350066 (-) | 786 | WP_031900157.1 | ATP-binding protein | - |
| SRS_RS06630 | - | 1350079..1350810 (-) | 732 | WP_045178953.1 | helix-turn-helix domain-containing protein | - |
| SRS_RS06635 | - | 1350803..1351477 (-) | 675 | WP_045178956.1 | putative HNHc nuclease | - |
| SRS_RS06640 | ssbA | 1351491..1351919 (-) | 429 | WP_045178958.1 | single-stranded DNA-binding protein | Machinery gene |
| SRS_RS06645 | - | 1351919..1352557 (-) | 639 | WP_001043063.1 | ERF family protein | - |
| SRS_RS06650 | - | 1352557..1353036 (-) | 480 | Protein_1303 | siphovirus Gp157 family protein | - |
| SRS_RS06655 | - | 1353051..1353311 (-) | 261 | WP_045178961.1 | DUF1108 family protein | - |
| SRS_RS06660 | - | 1353375..1353689 (-) | 315 | WP_045178963.1 | hypothetical protein | - |
| SRS_RS06665 | - | 1353694..1353864 (-) | 171 | WP_031782757.1 | DUF1270 domain-containing protein | - |
| SRS_RS15875 | - | 1353857..1353985 (-) | 129 | WP_001559112.1 | hypothetical protein | - |
| SRS_RS06670 | - | 1354044..1354274 (+) | 231 | WP_000395457.1 | hypothetical protein | - |
| SRS_RS06675 | - | 1354478..1354672 (-) | 195 | WP_000390105.1 | hypothetical protein | - |
| SRS_RS06680 | - | 1354689..1355453 (-) | 765 | WP_001148560.1 | phage antirepressor | - |
| SRS_RS06685 | - | 1355530..1355742 (-) | 213 | WP_000132644.1 | helix-turn-helix transcriptional regulator | - |
| SRS_RS06690 | - | 1355895..1356209 (+) | 315 | WP_001118607.1 | helix-turn-helix domain-containing protein | - |
| SRS_RS06695 | - | 1356231..1356689 (+) | 459 | WP_045178970.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SRS_RS06700 | - | 1356827..1357732 (+) | 906 | WP_045178971.1 | hypothetical protein | - |
| SRS_RS06705 | - | 1357669..1357869 (-) | 201 | WP_000143212.1 | excisionase | - |
| SRS_RS06710 | - | 1357977..1359362 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
| SRS_RS06715 | rpmF | 1359479..1359652 (-) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| SRS_RS06725 | - | 1359732..1360289 (-) | 558 | WP_000872158.1 | YceD family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16020.59 Da Isoelectric Point: 5.8724
>NTDB_id=1113681 SRS_RS06640 WP_045178958.1 1351491..1351919(-) (ssbA) [Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1]
MLNRTVLVGRLTKDPEYRTTPDGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPDGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1113681 SRS_RS06640 WP_045178958.1 1351491..1351919(-) (ssbA) [Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1]
ATGCTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGGATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGCTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGGATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.613 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |