Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACOCJF_RS08415 | Genome accession | NZ_CP184555 |
| Coordinates | 1679307..1679618 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SCTW2018694 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1674307..1684618
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACOCJF_RS08385 (ACOCJF_08385) | - | 1675090..1675293 (+) | 204 | WP_000087559.1 | YqgQ family protein | - |
| ACOCJF_RS08390 (ACOCJF_08390) | - | 1675290..1676276 (+) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| ACOCJF_RS08395 (ACOCJF_08395) | - | 1676276..1676605 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| ACOCJF_RS08400 (ACOCJF_08400) | - | 1676602..1677225 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| ACOCJF_RS08405 (ACOCJF_08405) | comGA | 1677277..1678251 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACOCJF_RS08410 (ACOCJF_08410) | comGB | 1678223..1679293 (+) | 1071 | WP_000776425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACOCJF_RS08415 (ACOCJF_08415) | comGC | 1679307..1679618 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACOCJF_RS08420 (ACOCJF_08420) | comGD | 1679596..1680042 (+) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACOCJF_RS08425 (ACOCJF_08425) | comGE | 1680029..1680328 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| ACOCJF_RS08430 (ACOCJF_08430) | comGF | 1680246..1680743 (+) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACOCJF_RS08435 (ACOCJF_08435) | - | 1680840..1680986 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| ACOCJF_RS08440 (ACOCJF_08440) | - | 1680976..1681500 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| ACOCJF_RS08445 (ACOCJF_08445) | gcvT | 1681659..1682750 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACOCJF_RS08450 (ACOCJF_08450) | gcvPA | 1682770..1684116 (+) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=1109410 ACOCJF_RS08415 WP_000472256.1 1679307..1679618(+) (comGC) [Staphylococcus aureus strain SCTW2018694]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1109410 ACOCJF_RS08415 WP_000472256.1 1679307..1679618(+) (comGC) [Staphylococcus aureus strain SCTW2018694]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |