Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACM6AJ_RS10285 | Genome accession | NZ_CP181111 |
| Coordinates | 2058897..2059325 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934782.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain AG21-0610 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2021952..2067063 | 2058897..2059325 | within | 0 |
Gene organization within MGE regions
Location: 2021952..2067063
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACM6AJ_RS09995 (ACM6AJ_09995) | - | 2021952..2022467 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| ACM6AJ_RS10000 (ACM6AJ_10000) | - | 2022598..2022759 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| ACM6AJ_RS10005 (ACM6AJ_10005) | - | 2023106..2023186 (+) | 81 | WP_100250272.1 | hypothetical protein | - |
| ACM6AJ_RS10010 (ACM6AJ_10010) | - | 2023512..2023697 (-) | 186 | WP_001286805.1 | hypothetical protein | - |
| ACM6AJ_RS10015 (ACM6AJ_10015) | - | 2023699..2023809 (-) | 111 | WP_000139423.1 | hypothetical protein | - |
| ACM6AJ_RS10020 (ACM6AJ_10020) | - | 2023880..2024032 (-) | 153 | WP_001788502.1 | hypothetical protein | - |
| ACM6AJ_RS10025 (ACM6AJ_10025) | - | 2024275..2025720 (-) | 1446 | WP_031905172.1 | SH3 domain-containing protein | - |
| ACM6AJ_RS10030 (ACM6AJ_10030) | - | 2025701..2026138 (-) | 438 | WP_000354121.1 | phage holin | - |
| ACM6AJ_RS10035 (ACM6AJ_10035) | - | 2026194..2026589 (-) | 396 | WP_000398862.1 | hypothetical protein | - |
| ACM6AJ_RS10040 (ACM6AJ_10040) | - | 2026595..2027767 (-) | 1173 | WP_048525271.1 | BppU family phage baseplate upper protein | - |
| ACM6AJ_RS10045 (ACM6AJ_10045) | - | 2027780..2029678 (-) | 1899 | WP_000524007.1 | glucosaminidase domain-containing protein | - |
| ACM6AJ_RS10050 (ACM6AJ_10050) | - | 2029815..2030114 (-) | 300 | WP_015977953.1 | DUF2951 domain-containing protein | - |
| ACM6AJ_RS10055 (ACM6AJ_10055) | - | 2030155..2030328 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| ACM6AJ_RS10060 (ACM6AJ_10060) | - | 2030332..2030709 (-) | 378 | WP_015977952.1 | DUF2977 domain-containing protein | - |
| ACM6AJ_RS10065 (ACM6AJ_10065) | - | 2030709..2032532 (-) | 1824 | WP_015977938.1 | phage baseplate upper protein | - |
| ACM6AJ_RS10070 (ACM6AJ_10070) | - | 2032532..2034442 (-) | 1911 | WP_031905173.1 | hypothetical protein | - |
| ACM6AJ_RS10075 (ACM6AJ_10075) | - | 2034457..2036358 (-) | 1902 | WP_000156404.1 | SGNH/GDSL hydrolase family protein | - |
| ACM6AJ_RS10080 (ACM6AJ_10080) | - | 2036367..2037314 (-) | 948 | WP_000350680.1 | phage tail family protein | - |
| ACM6AJ_RS10085 (ACM6AJ_10085) | - | 2037327..2040794 (-) | 3468 | WP_031905174.1 | membrane protein | - |
| ACM6AJ_RS10090 (ACM6AJ_10090) | - | 2040811..2041155 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| ACM6AJ_RS10095 (ACM6AJ_10095) | - | 2041185..2041550 (-) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| ACM6AJ_RS10100 (ACM6AJ_10100) | - | 2041612..2042193 (-) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| ACM6AJ_RS10105 (ACM6AJ_10105) | - | 2042212..2042595 (-) | 384 | WP_000188649.1 | hypothetical protein | - |
| ACM6AJ_RS10110 (ACM6AJ_10110) | - | 2042607..2042954 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACM6AJ_RS10115 (ACM6AJ_10115) | - | 2042954..2043256 (-) | 303 | WP_001268312.1 | hypothetical protein | - |
| ACM6AJ_RS10120 (ACM6AJ_10120) | - | 2043253..2043585 (-) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| ACM6AJ_RS10125 (ACM6AJ_10125) | - | 2043594..2043881 (-) | 288 | WP_001114091.1 | hypothetical protein | - |
| ACM6AJ_RS10130 (ACM6AJ_10130) | - | 2043903..2044877 (-) | 975 | WP_000438502.1 | phage major capsid protein | - |
| ACM6AJ_RS10135 (ACM6AJ_10135) | - | 2044891..2045511 (-) | 621 | WP_000392140.1 | DUF4355 domain-containing protein | - |
| ACM6AJ_RS10140 (ACM6AJ_10140) | - | 2045505..2045592 (-) | 88 | Protein_1959 | hypothetical protein | - |
| ACM6AJ_RS10145 (ACM6AJ_10145) | - | 2045620..2045790 (-) | 171 | WP_000072206.1 | hypothetical protein | - |
| ACM6AJ_RS10150 (ACM6AJ_10150) | - | 2045863..2046858 (-) | 996 | WP_001555735.1 | minor capsid protein | - |
| ACM6AJ_RS10155 (ACM6AJ_10155) | - | 2046865..2048400 (-) | 1536 | WP_031905175.1 | phage portal protein | - |
| ACM6AJ_RS10160 (ACM6AJ_10160) | - | 2048411..2049688 (-) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| ACM6AJ_RS10165 (ACM6AJ_10165) | - | 2049675..2050115 (-) | 441 | WP_001003271.1 | terminase small subunit | - |
| ACM6AJ_RS10170 (ACM6AJ_10170) | - | 2050302..2050721 (-) | 420 | WP_001647551.1 | RinA family phage transcriptional regulator | - |
| ACM6AJ_RS10175 (ACM6AJ_10175) | - | 2050737..2050883 (-) | 147 | WP_000990005.1 | hypothetical protein | - |
| ACM6AJ_RS10180 (ACM6AJ_10180) | rinB | 2050884..2051057 (-) | 174 | WP_024937262.1 | transcriptional activator RinB | - |
| ACM6AJ_RS10185 (ACM6AJ_10185) | - | 2051050..2051286 (-) | 237 | WP_000483477.1 | hypothetical protein | - |
| ACM6AJ_RS10190 (ACM6AJ_10190) | - | 2051311..2051544 (-) | 234 | WP_031905176.1 | DUF1381 domain-containing protein | - |
| ACM6AJ_RS10195 (ACM6AJ_10195) | - | 2051713..2051958 (-) | 246 | WP_031905177.1 | hypothetical protein | - |
| ACM6AJ_RS10200 (ACM6AJ_10200) | - | 2051995..2052528 (-) | 534 | WP_048525261.1 | dUTP diphosphatase | - |
| ACM6AJ_RS10205 (ACM6AJ_10205) | - | 2052521..2052769 (-) | 249 | WP_031905179.1 | DUF1024 family protein | - |
| ACM6AJ_RS10210 (ACM6AJ_10210) | - | 2052762..2053071 (-) | 310 | Protein_1973 | hypothetical protein | - |
| ACM6AJ_RS10215 (ACM6AJ_10215) | - | 2053068..2053448 (-) | 381 | WP_031905180.1 | YopX family protein | - |
| ACM6AJ_RS10220 (ACM6AJ_10220) | - | 2053439..2053639 (-) | 201 | WP_031905181.1 | hypothetical protein | - |
| ACM6AJ_RS10225 (ACM6AJ_10225) | - | 2053636..2054037 (-) | 402 | WP_031905182.1 | hypothetical protein | - |
| ACM6AJ_RS10230 (ACM6AJ_10230) | - | 2054052..2054300 (-) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| ACM6AJ_RS10235 (ACM6AJ_10235) | - | 2054301..2054660 (-) | 360 | WP_015581853.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACM6AJ_RS10240 (ACM6AJ_10240) | - | 2054661..2054929 (-) | 269 | Protein_1979 | helix-turn-helix domain-containing protein | - |
| ACM6AJ_RS10245 (ACM6AJ_10245) | - | 2054930..2055115 (-) | 186 | WP_001187263.1 | DUF3113 family protein | - |
| ACM6AJ_RS10250 (ACM6AJ_10250) | - | 2055120..2055524 (-) | 405 | WP_000049795.1 | DUF1064 domain-containing protein | - |
| ACM6AJ_RS10255 (ACM6AJ_10255) | - | 2055535..2055756 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| ACM6AJ_RS10260 (ACM6AJ_10260) | - | 2055769..2055930 (-) | 162 | WP_000237153.1 | hypothetical protein | - |
| ACM6AJ_RS10265 (ACM6AJ_10265) | - | 2055924..2056703 (-) | 780 | WP_000803056.1 | ATP-binding protein | - |
| ACM6AJ_RS10270 (ACM6AJ_10270) | - | 2056715..2057458 (-) | 744 | WP_000139436.1 | conserved phage C-terminal domain-containing protein | - |
| ACM6AJ_RS10275 (ACM6AJ_10275) | - | 2057451..2058215 (-) | 765 | WP_000240900.1 | AP2 domain-containing protein | - |
| ACM6AJ_RS10280 (ACM6AJ_10280) | - | 2058215..2058883 (-) | 669 | WP_001121805.1 | putative HNHc nuclease | - |
| ACM6AJ_RS10285 (ACM6AJ_10285) | ssbA | 2058897..2059325 (-) | 429 | WP_000934782.1 | single-stranded DNA-binding protein | Machinery gene |
| ACM6AJ_RS10290 (ACM6AJ_10290) | - | 2059325..2059948 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| ACM6AJ_RS10295 (ACM6AJ_10295) | - | 2059941..2060162 (-) | 222 | WP_001077280.1 | DUF2483 family protein | - |
| ACM6AJ_RS10300 (ACM6AJ_10300) | - | 2060172..2060432 (-) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| ACM6AJ_RS10305 (ACM6AJ_10305) | - | 2060529..2060690 (-) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| ACM6AJ_RS10310 (ACM6AJ_10310) | - | 2060683..2060904 (-) | 222 | WP_000594789.1 | hypothetical protein | - |
| ACM6AJ_RS10315 (ACM6AJ_10315) | - | 2060975..2061205 (+) | 231 | WP_000395455.1 | hypothetical protein | - |
| ACM6AJ_RS10320 (ACM6AJ_10320) | - | 2061387..2061581 (-) | 195 | WP_001148857.1 | hypothetical protein | - |
| ACM6AJ_RS10325 (ACM6AJ_10325) | - | 2061598..2062362 (-) | 765 | WP_031880731.1 | phage antirepressor KilAC domain-containing protein | - |
| ACM6AJ_RS10330 (ACM6AJ_10330) | - | 2062362..2062556 (-) | 195 | WP_000108121.1 | helix-turn-helix domain-containing protein | - |
| ACM6AJ_RS10335 (ACM6AJ_10335) | - | 2062819..2063151 (+) | 333 | WP_001055142.1 | helix-turn-helix domain-containing protein | - |
| ACM6AJ_RS10340 (ACM6AJ_10340) | - | 2063168..2063842 (+) | 675 | WP_000775189.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACM6AJ_RS10345 (ACM6AJ_10345) | - | 2063871..2064596 (+) | 726 | Protein_2000 | PH domain-containing protein | - |
| ACM6AJ_RS10350 (ACM6AJ_10350) | - | 2064813..2065745 (+) | 933 | WP_000392183.1 | hypothetical protein | - |
| ACM6AJ_RS10355 (ACM6AJ_10355) | - | 2065725..2065904 (-) | 180 | WP_000337827.1 | hypothetical protein | - |
| ACM6AJ_RS10360 (ACM6AJ_10360) | - | 2066017..2067063 (+) | 1047 | WP_031784789.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15980.48 Da Isoelectric Point: 5.8724
>NTDB_id=1098449 ACM6AJ_RS10285 WP_000934782.1 2058897..2059325(-) (ssbA) [Staphylococcus aureus strain AG21-0610]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1098449 ACM6AJ_RS10285 WP_000934782.1 2058897..2059325(-) (ssbA) [Staphylococcus aureus strain AG21-0610]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.599 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |