Detailed information NTG1095090

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACMVYP_RS09355
• Genome accession: NZ_CP180295
• Coordinates: 1872190..1872501 (-)
• Length: 103 a.a.
• NCBI ID: WP_017176238.1
• Uniprot ID: -
• Organism: Staphylococcus hominis strain YSMAS1_1_A7
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1867190..1877501

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACMVYP_RS09330 (ACMVYP_09330)	gcvPA	1867748..1869100 (-)	1353	WP_017176244.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
ACMVYP_RS09335 (ACMVYP_09335)	gcvT	1869117..1870208 (-)	1092	WP_017176243.1	glycine cleavage system aminomethyltransferase GcvT	-
ACMVYP_RS09340 (ACMVYP_09340)	-	1870403..1870912 (-)	510	WP_017176242.1	shikimate kinase	-
ACMVYP_RS09345 (ACMVYP_09345)	-	1871077..1871574 (-)	498	WP_017176240.1	competence protein ComG	-
ACMVYP_RS09350 (ACMVYP_09350)	comGD	1871766..1872200 (-)	435	WP_017176239.1	competence type IV pilus minor pilin ComGD	-
ACMVYP_RS09355 (ACMVYP_09355)	comGC	1872190..1872501 (-)	312	WP_017176238.1	competence type IV pilus major pilin ComGC	Machinery gene
ACMVYP_RS09360 (ACMVYP_09360)	comGB	1872521..1873579 (-)	1059	WP_048681721.1	competence type IV pilus assembly protein ComGB	-
ACMVYP_RS09365 (ACMVYP_09365)	comGA	1873557..1874531 (-)	975	WP_017176236.1	competence type IV pilus ATPase ComGA	Machinery gene
ACMVYP_RS09370 (ACMVYP_09370)	-	1874582..1875208 (-)	627	WP_017176235.1	MBL fold metallo-hydrolase	-
ACMVYP_RS09375 (ACMVYP_09375)	-	1875210..1875533 (-)	324	WP_017176234.1	MTH1187 family thiamine-binding protein	-
ACMVYP_RS09380 (ACMVYP_09380)	-	1875533..1876519 (-)	987	WP_002449785.1	ROK family glucokinase	-
ACMVYP_RS09385 (ACMVYP_09385)	-	1876516..1876719 (-)	204	WP_017176233.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11400.52 Da
• Isoelectric Point: 9.1831

>NTDB_id=1095090 ACMVYP_RS09355 WP_017176238.1 1872190..1872501(-) (comGC) [Staphylococcus hominis strain YSMAS1_1_A7]
MKKFKNKLKAFTLIEMLLVLLIISVLLILIIPNIAKQMSHIQSTGCEAQVKMVNSQIEAYTLKHNRVPNSIEDLVTEGFI
KQGQSSCKSGETISIKNGEAVAE

Nucleotide

• Length: 312 bp

>NTDB_id=1095090 ACMVYP_RS09355 WP_017176238.1 1872190..1872501(-) (comGC) [Staphylococcus hominis strain YSMAS1_1_A7]
ATGAAAAAATTCAAAAATAAATTAAAAGCTTTTACTTTAATTGAGATGTTACTTGTACTATTAATAATTAGTGTTTTACT
CATTCTTATTATTCCGAATATAGCTAAACAAATGTCACATATTCAATCAACAGGATGTGAAGCACAAGTGAAAATGGTCA
ATAGTCAAATTGAAGCTTATACTTTAAAACATAATAGAGTTCCTAATTCTATTGAGGACTTAGTAACTGAAGGGTTTATA
AAACAAGGGCAATCATCTTGTAAGTCTGGAGAAACTATCAGTATTAAAAATGGAGAAGCAGTTGCAGAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	79.412	99.029	0.786
comGC	Staphylococcus aureus MW2	79.412	99.029	0.786
comGC/cglC	Streptococcus mitis SK321	46.875	93.204	0.437
comGC/cglC	Streptococcus pneumoniae D39	45.833	93.204	0.427
comGC/cglC	Streptococcus pneumoniae R6	45.833	93.204	0.427
comGC/cglC	Streptococcus pneumoniae TIGR4	45.833	93.204	0.427
comGC/cglC	Streptococcus pneumoniae Rx1	45.833	93.204	0.427
comYC	Streptococcus mutans UA140	48.315	86.408	0.417
comYC	Streptococcus mutans UA159	48.315	86.408	0.417
comGC	Bacillus subtilis subsp. subtilis str. 168	44.211	92.233	0.408
comYC	Streptococcus gordonii str. Challis substr. CH1	47.727	85.437	0.408
comYC	Streptococcus suis isolate S10	46.512	83.495	0.388
comGC/cglC	Streptococcus mitis NCTC 12261	48.193	80.583	0.388