Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACG4EF_RS03475 | Genome accession | NZ_CP172259 |
| Coordinates | 704043..704468 (+) | Length | 141 a.a. |
| NCBI ID | WP_397321275.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain XJ-24 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 694704..739717 | 704043..704468 | within | 0 |
Gene organization within MGE regions
Location: 694704..739717
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACG4EF_RS03400 (ACG4EF_03400) | - | 694704..695393 (-) | 690 | WP_201197918.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| ACG4EF_RS03405 (ACG4EF_03405) | - | 695788..696867 (-) | 1080 | WP_397321268.1 | tyrosine-type recombinase/integrase | - |
| ACG4EF_RS03410 (ACG4EF_03410) | - | 697006..697920 (-) | 915 | WP_201197919.1 | DUF5067 domain-containing protein | - |
| ACG4EF_RS03415 (ACG4EF_03415) | - | 697939..698583 (-) | 645 | WP_201197920.1 | hypothetical protein | - |
| ACG4EF_RS03420 (ACG4EF_03420) | - | 698645..699055 (-) | 411 | WP_201197921.1 | hypothetical protein | - |
| ACG4EF_RS03425 (ACG4EF_03425) | - | 699059..699397 (-) | 339 | WP_236252657.1 | XRE family transcriptional regulator | - |
| ACG4EF_RS03430 (ACG4EF_03430) | - | 699661..699849 (+) | 189 | WP_201197922.1 | helix-turn-helix domain-containing protein | - |
| ACG4EF_RS03435 (ACG4EF_03435) | - | 699862..700317 (+) | 456 | WP_201197923.1 | hypothetical protein | - |
| ACG4EF_RS03440 (ACG4EF_03440) | - | 700336..701070 (+) | 735 | WP_397321269.1 | Rha family transcriptional regulator | - |
| ACG4EF_RS03445 (ACG4EF_03445) | - | 701139..701345 (+) | 207 | WP_075139784.1 | hypothetical protein | - |
| ACG4EF_RS03450 (ACG4EF_03450) | - | 701440..702522 (+) | 1083 | WP_397321270.1 | N-6 DNA methylase | - |
| ACG4EF_RS03455 (ACG4EF_03455) | - | 702528..702707 (+) | 180 | WP_397321271.1 | hypothetical protein | - |
| ACG4EF_RS03460 (ACG4EF_03460) | - | 702697..703152 (+) | 456 | WP_397321272.1 | chromosome segregation protein SMC | - |
| ACG4EF_RS03465 (ACG4EF_03465) | - | 703153..703851 (+) | 699 | WP_397321273.1 | ERF family protein | - |
| ACG4EF_RS03470 (ACG4EF_03470) | - | 703844..704050 (+) | 207 | WP_397321274.1 | hypothetical protein | - |
| ACG4EF_RS03475 (ACG4EF_03475) | ssb | 704043..704468 (+) | 426 | WP_397321275.1 | single-stranded DNA-binding protein | Machinery gene |
| ACG4EF_RS03480 (ACG4EF_03480) | - | 704480..705178 (+) | 699 | WP_397321276.1 | putative HNHc nuclease | - |
| ACG4EF_RS03485 (ACG4EF_03485) | - | 705159..705923 (+) | 765 | WP_397321277.1 | conserved phage C-terminal domain-containing protein | - |
| ACG4EF_RS03490 (ACG4EF_03490) | - | 705937..706719 (+) | 783 | WP_397321278.1 | ATP-binding protein | - |
| ACG4EF_RS03495 (ACG4EF_03495) | - | 706837..707469 (+) | 633 | WP_397321279.1 | RNA polymerase subunit sigma-70 | - |
| ACG4EF_RS03500 (ACG4EF_03500) | - | 707450..707851 (+) | 402 | WP_397321280.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACG4EF_RS03505 (ACG4EF_03505) | - | 707848..707997 (+) | 150 | WP_397321281.1 | hypothetical protein | - |
| ACG4EF_RS03510 (ACG4EF_03510) | - | 707984..708355 (+) | 372 | WP_397321282.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ACG4EF_RS03515 (ACG4EF_03515) | - | 708525..708758 (+) | 234 | WP_397321283.1 | hypothetical protein | - |
| ACG4EF_RS03520 (ACG4EF_03520) | - | 708748..709086 (+) | 339 | WP_330156159.1 | hypothetical protein | - |
| ACG4EF_RS03525 (ACG4EF_03525) | - | 709079..709399 (+) | 321 | WP_330156160.1 | hypothetical protein | - |
| ACG4EF_RS03530 (ACG4EF_03530) | - | 709456..709869 (+) | 414 | WP_330156161.1 | hypothetical protein | - |
| ACG4EF_RS03535 (ACG4EF_03535) | - | 709899..710207 (+) | 309 | WP_397321284.1 | hypothetical protein | - |
| ACG4EF_RS03540 (ACG4EF_03540) | - | 710207..710464 (+) | 258 | WP_397321285.1 | hypothetical protein | - |
| ACG4EF_RS03545 (ACG4EF_03545) | - | 710464..710802 (+) | 339 | WP_075139800.1 | hypothetical protein | - |
| ACG4EF_RS03550 (ACG4EF_03550) | - | 710906..711349 (+) | 444 | WP_397321286.1 | hypothetical protein | - |
| ACG4EF_RS03555 (ACG4EF_03555) | - | 711886..712377 (+) | 492 | WP_397321287.1 | terminase small subunit | - |
| ACG4EF_RS03560 (ACG4EF_03560) | - | 712370..713716 (+) | 1347 | WP_397321288.1 | PBSX family phage terminase large subunit | - |
| ACG4EF_RS03565 (ACG4EF_03565) | - | 713798..715132 (+) | 1335 | WP_397321289.1 | phage portal protein | - |
| ACG4EF_RS03570 (ACG4EF_03570) | - | 715101..716084 (+) | 984 | WP_397321290.1 | minor capsid protein | - |
| ACG4EF_RS03575 (ACG4EF_03575) | - | 716188..716907 (+) | 720 | WP_397321291.1 | DUF4355 domain-containing protein | - |
| ACG4EF_RS03580 (ACG4EF_03580) | - | 716907..717722 (+) | 816 | WP_397321292.1 | N4-gp56 family major capsid protein | - |
| ACG4EF_RS03585 (ACG4EF_03585) | - | 717740..718006 (+) | 267 | WP_397321341.1 | Ig-like domain-containing protein | - |
| ACG4EF_RS03590 (ACG4EF_03590) | - | 718018..718392 (+) | 375 | WP_397321293.1 | phage head-tail connector protein | - |
| ACG4EF_RS03595 (ACG4EF_03595) | - | 718397..718702 (+) | 306 | WP_397321294.1 | hypothetical protein | - |
| ACG4EF_RS03600 (ACG4EF_03600) | - | 718695..719036 (+) | 342 | WP_285110031.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACG4EF_RS03605 (ACG4EF_03605) | - | 719037..719438 (+) | 402 | WP_397321295.1 | hypothetical protein | - |
| ACG4EF_RS03610 (ACG4EF_03610) | - | 719455..720060 (+) | 606 | WP_397321296.1 | phage major tail protein, TP901-1 family | - |
| ACG4EF_RS03615 (ACG4EF_03615) | - | 720075..720581 (+) | 507 | WP_397321297.1 | Ig domain-containing protein | - |
| ACG4EF_RS03620 (ACG4EF_03620) | - | 720644..720979 (+) | 336 | WP_397321298.1 | tail assembly chaperone | - |
| ACG4EF_RS03625 (ACG4EF_03625) | - | 721060..721395 (+) | 336 | WP_397321299.1 | hypothetical protein | - |
| ACG4EF_RS03630 (ACG4EF_03630) | - | 721379..724399 (+) | 3021 | WP_397321300.1 | phage tail tape measure protein | - |
| ACG4EF_RS03635 (ACG4EF_03635) | - | 724399..725160 (+) | 762 | WP_397321301.1 | phage tail protein | - |
| ACG4EF_RS03640 (ACG4EF_03640) | - | 725160..728105 (+) | 2946 | WP_397321302.1 | phage tail protein | - |
| ACG4EF_RS03645 (ACG4EF_03645) | - | 728105..728518 (+) | 414 | WP_075139818.1 | hypothetical protein | - |
| ACG4EF_RS03650 (ACG4EF_03650) | - | 728522..730258 (+) | 1737 | WP_397321303.1 | BppU family phage baseplate upper protein | - |
| ACG4EF_RS03655 (ACG4EF_03655) | - | 730251..731210 (+) | 960 | WP_397321304.1 | hypothetical protein | - |
| ACG4EF_RS03660 (ACG4EF_03660) | - | 731210..731488 (+) | 279 | WP_075139821.1 | hypothetical protein | - |
| ACG4EF_RS03665 (ACG4EF_03665) | - | 731488..731634 (+) | 147 | WP_075139822.1 | XkdX family protein | - |
| ACG4EF_RS03670 (ACG4EF_03670) | - | 731585..731968 (+) | 384 | WP_229092876.1 | hypothetical protein | - |
| ACG4EF_RS03675 (ACG4EF_03675) | - | 731968..732210 (+) | 243 | WP_128211673.1 | phage holin | - |
| ACG4EF_RS03680 (ACG4EF_03680) | - | 732194..733315 (+) | 1122 | WP_201197725.1 | peptidoglycan recognition family protein | - |
| ACG4EF_RS03685 (ACG4EF_03685) | - | 734060..734908 (+) | 849 | WP_397321342.1 | ROK family protein | - |
| ACG4EF_RS03690 (ACG4EF_03690) | - | 734889..735620 (+) | 732 | WP_397321305.1 | sugar phosphate isomerase/epimerase family protein | - |
| ACG4EF_RS03695 (ACG4EF_03695) | - | 735874..737382 (+) | 1509 | WP_004165605.1 | sodium:solute symporter | - |
| ACG4EF_RS03700 (ACG4EF_03700) | - | 737397..738314 (+) | 918 | WP_201197959.1 | dihydrodipicolinate synthase family protein | - |
| ACG4EF_RS03705 (ACG4EF_03705) | - | 739361..739717 (+) | 357 | WP_236252674.1 | AP2 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15679.41 Da Isoelectric Point: 7.1664
>NTDB_id=1065963 ACG4EF_RS03475 WP_397321275.1 704043..704468(+) (ssb) [Pediococcus acidilactici strain XJ-24]
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNVRQSTTPGDPFANGGQSIDIGDDDLPF
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNVRQSTTPGDPFANGGQSIDIGDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1065963 ACG4EF_RS03475 WP_397321275.1 704043..704468(+) (ssb) [Pediococcus acidilactici strain XJ-24]
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCTAAGTATACACACAAGGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAAACCCGT
TCGTACGAAAATCAACAAGGGCAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGTACGGCAATCTACAACGCCGGGAGACCCGTTCGCTAATGGCGGGCAGTCAATCGATA
TTGGTGACGACGATTTACCGTTCTAG
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCTAAGTATACACACAAGGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAAACCCGT
TCGTACGAAAATCAACAAGGGCAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGTACGGCAATCTACAACGCCGGGAGACCCGTTCGCTAATGGCGGGCAGTCAATCGATA
TTGGTGACGACGATTTACCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
60 |
100 |
0.723 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.488 |
100 |
0.652 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
61.111 |
76.596 |
0.468 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.135 |
100 |
0.411 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.278 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.278 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.583 |
100 |
0.404 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.583 |
100 |
0.404 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.583 |
100 |
0.404 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.583 |
100 |
0.404 |
| ssbA | Streptococcus mutans UA159 |
37.589 |
100 |
0.376 |