Detailed information NTG1056978

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACFIOT_RS06125
• Genome accession: NZ_CP170414
• Coordinates: 1198342..1198653 (+)
• Length: 103 a.a.
• NCBI ID: WP_054190026.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain t5047
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1193342..1203653

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACFIOT_RS06095	-	1194125..1194328 (+)	204	WP_000087561.1	YqgQ family protein	-
ACFIOT_RS06100	-	1194325..1195311 (+)	987	WP_000161315.1	ROK family glucokinase	-
ACFIOT_RS06105	-	1195311..1195640 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
ACFIOT_RS06110	-	1195637..1196260 (+)	624	WP_054190028.1	MBL fold metallo-hydrolase	-
ACFIOT_RS06115	comGA	1196312..1197286 (+)	975	WP_054191886.1	competence type IV pilus ATPase ComGA	Machinery gene
ACFIOT_RS06120	comGB	1197258..1198328 (+)	1071	WP_054190027.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACFIOT_RS06125	comGC	1198342..1198653 (+)	312	WP_054190026.1	competence type IV pilus major pilin ComGC	Machinery gene
ACFIOT_RS06130	comGD	1198631..1199077 (+)	447	WP_077446655.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACFIOT_RS06135	comGE	1199064..1199363 (+)	300	WP_054190024.1	hypothetical protein	Machinery gene
ACFIOT_RS06140	comGF	1199281..1199778 (+)	498	WP_077446653.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACFIOT_RS06145	-	1199875..1200021 (+)	147	WP_001789879.1	hypothetical protein	-
ACFIOT_RS06150	-	1200011..1200535 (+)	525	WP_054190023.1	shikimate kinase	-
ACFIOT_RS06155	gcvT	1200694..1201785 (+)	1092	WP_054190022.1	glycine cleavage system aminomethyltransferase GcvT	-
ACFIOT_RS06160	gcvPA	1201805..1203151 (+)	1347	WP_054190021.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11329.38 Da
• Isoelectric Point: 8.5268

>NTDB_id=1056978 ACFIOT_RS06125 WP_054190026.1 1198342..1198653(+) (comGC) [Staphylococcus aureus strain t5047]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIAEGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1056978 ACFIOT_RS06125 WP_054190026.1 1198342..1198653(+) (comGC) [Staphylococcus aureus strain t5047]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGAGGGTTTCATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC/cglC	Streptococcus pneumoniae TIGR4	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae D39	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae R6	45.098	99.029	0.447
comGC/cglC	Streptococcus mitis SK321	50	83.495	0.417
comGC/cglC	Streptococcus mitis NCTC 12261	50	83.495	0.417
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	42.857	88.35	0.379
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369