Detailed information NTG1055874

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACFDA9_RS06180
• Genome accession: NZ_CP170245
• Coordinates: 1280883..1281200 (+)
• Length: 105 a.a.
• NCBI ID: WP_381405476.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain Q17
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1275883..1286200

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACFDA9_RS06150 (ACFDA9_06145)	-	1276660..1276860 (+)	201	WP_002446537.1	YqgQ family protein	-
ACFDA9_RS06155 (ACFDA9_06150)	-	1276860..1277846 (+)	987	WP_002446536.1	ROK family glucokinase	-
ACFDA9_RS06160 (ACFDA9_06155)	-	1277846..1278172 (+)	327	WP_070853595.1	MTH1187 family thiamine-binding protein	-
ACFDA9_RS06165 (ACFDA9_06160)	-	1278172..1278795 (+)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
ACFDA9_RS06170 (ACFDA9_06165)	comGA	1278852..1279826 (+)	975	WP_145377817.1	competence type IV pilus ATPase ComGA	Machinery gene
ACFDA9_RS06175 (ACFDA9_06170)	comGB	1279798..1280865 (+)	1068	WP_002446533.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACFDA9_RS06180 (ACFDA9_06175)	comGC	1280883..1281200 (+)	318	WP_381405476.1	competence type IV pilus major pilin ComGC	Machinery gene
ACFDA9_RS06185 (ACFDA9_06180)	comGD	1281190..1281627 (+)	438	WP_002446531.1	competence type IV pilus minor pilin ComGD	-
ACFDA9_RS06190 (ACFDA9_06185)	-	1281614..1281907 (+)	294	WP_002446530.1	hypothetical protein	-
ACFDA9_RS06195 (ACFDA9_06190)	-	1281831..1282322 (+)	492	WP_070853594.1	competence type IV pilus minor pilin ComGF	-
ACFDA9_RS06200 (ACFDA9_06195)	-	1282487..1282999 (+)	513	WP_002457723.1	shikimate kinase	-
ACFDA9_RS06205 (ACFDA9_06200)	gcvT	1283217..1284308 (+)	1092	WP_002457722.1	glycine cleavage system aminomethyltransferase GcvT	-
ACFDA9_RS06210 (ACFDA9_06205)	gcvPA	1284328..1285674 (+)	1347	WP_002446526.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11492.52 Da
• Isoelectric Point: 8.5267

>NTDB_id=1055874 ACFDA9_RS06180 WP_381405476.1 1280883..1281200(+) (comGC) [Staphylococcus epidermidis strain Q17]
MKTLKLLKQTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRDPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=1055874 ACFDA9_RS06180 WP_381405476.1 1280883..1281200(+) (comGC) [Staphylococcus epidermidis strain Q17]
ATGAAAACATTGAAATTATTGAAACAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATCAGTTT
ATTATTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAACCGCGACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	85.294	97.143	0.829
comGC	Staphylococcus aureus MW2	85.294	97.143	0.829
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	48.837	81.905	0.4
comYC	Streptococcus mutans UA140	48.837	81.905	0.4
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	72.381	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362