Detailed information NTG1052125

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ACE11B_RS01060
• Genome accession: NZ_CP169563
• Coordinates: 208124..208399 (+)
• Length: 91 a.a.
• NCBI ID: WP_029487321.1
• Uniprot ID: -
• Organism: Enterococcus gallinarum strain 574p
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 203124..213399

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACE11B_RS01035 (ACE11B_01035)	-	203257..204468 (+)	1212	WP_029487323.1	ABC transporter permease	-
ACE11B_RS01040 (ACE11B_01040)	-	204573..205352 (+)	780	WP_375035107.1	phosphotransferase family protein	-
ACE11B_RS01045 (ACE11B_01045)	trmB	205406..206068 (+)	663	WP_003128433.1	tRNA (guanosine(46)-N7)-methyltransferase TrmB	-
ACE11B_RS01050 (ACE11B_01050)	comGA	206180..207121 (+)	942	WP_005472888.1	competence type IV pilus ATPase ComGA	-
ACE11B_RS01055 (ACE11B_01055)	comGB	207096..208127 (+)	1032	WP_005472886.1	competence type IV pilus assembly protein ComGB	-
ACE11B_RS01060 (ACE11B_01060)	comYC	208124..208399 (+)	276	WP_029487321.1	competence type IV pilus major pilin ComGC	Machinery gene
ACE11B_RS01065 (ACE11B_01065)	comGD	208368..208847 (+)	480	WP_003128438.1	competence type IV pilus minor pilin ComGD	-
ACE11B_RS01070 (ACE11B_01070)	-	208858..209139 (+)	282	WP_005472881.1	hypothetical protein	-
ACE11B_RS01075 (ACE11B_01075)	comGF	209129..209542 (+)	414	WP_003128440.1	competence type IV pilus minor pilin ComGF	-
ACE11B_RS01080 (ACE11B_01080)	comGG	209592..209870 (+)	279	WP_276524362.1	competence type IV pilus minor pilin ComGG	-
ACE11B_RS01085 (ACE11B_01085)	-	210045..211052 (+)	1008	WP_029487317.1	class I SAM-dependent methyltransferase	-
ACE11B_RS01090 (ACE11B_01090)	-	211077..212261 (+)	1185	WP_003128443.1	acetate/propionate family kinase	-
ACE11B_RS01095 (ACE11B_01095)	-	212475..212786 (-)	312	WP_005472877.1	DUF1048 domain-containing protein	-
ACE11B_RS01100 (ACE11B_01100)	-	212796..213137 (-)	342	WP_003128445.1	DUF1048 domain-containing protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10464.26 Da
• Isoelectric Point: 6.4633

>NTDB_id=1052125 ACE11B_RS01060 WP_029487321.1 208124..208399(+) (comYC) [Enterococcus gallinarum strain 574p]
MRKLKHQGFTLVEMLIVLLVISILILLFVPNLSAQRTVIDEKGNAAIVKVVETQIELFQLNENRTPTRQELLAGNYVTEE
QYAIYLAHRNE

Nucleotide

• Length: 276 bp

>NTDB_id=1052125 ACE11B_RS01060 WP_029487321.1 208124..208399(+) (comYC) [Enterococcus gallinarum strain 574p]
ATGAGAAAATTGAAGCATCAAGGGTTCACATTGGTGGAGATGCTGATTGTACTGTTAGTGATCAGTATTTTGATTTTATT
GTTTGTACCAAACTTATCCGCACAACGTACAGTGATAGATGAGAAAGGAAATGCGGCAATCGTCAAAGTCGTAGAAACCC
AGATTGAGTTGTTCCAGCTTAATGAGAATCGAACACCTACTCGACAAGAATTACTAGCTGGAAATTATGTAACGGAGGAG
CAGTATGCGATTTACCTTGCCCATCGGAACGAATAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	51.613	100	0.527
comGC/cglC	Streptococcus mitis NCTC 12261	50.538	100	0.516
comYC	Streptococcus mutans UA159	48.387	100	0.495
comYC	Streptococcus mutans UA140	48.387	100	0.495
comGC/cglC	Streptococcus pneumoniae TIGR4	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae Rx1	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae D39	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae R6	48.352	100	0.484
comGC/cglC	Streptococcus mitis SK321	51.765	93.407	0.484
comGC	Lactococcus lactis subsp. cremoris KW2	50	96.703	0.484
comYC	Streptococcus gordonii str. Challis substr. CH1	48.315	97.802	0.473
comGC	Staphylococcus aureus MW2	44.872	85.714	0.385
comGC	Staphylococcus aureus N315	44.872	85.714	0.385