Detailed information
Bioinformatically predicted
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | ACEY2C_RS07445 | Genome accession | NZ_CP169314 |
| Coordinates | 1546573..1546848 (-) | Length | 91 a.a. |
| NCBI ID | WP_029487321.1 | Uniprot ID | - |
| Organism | Enterococcus gallinarum strain IFEGHNEK1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1508432..1564993 | 1546573..1546848 | within | 0 |
Gene organization within MGE regions
Location: 1508432..1564993
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEY2C_RS07260 (ACEY2C_07260) | - | 1508480..1509973 (-) | 1494 | WP_005472834.1 | phosphoglucomutase | - |
| ACEY2C_RS07265 (ACEY2C_07265) | - | 1510131..1510625 (-) | 495 | WP_003128475.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| ACEY2C_RS07270 (ACEY2C_07270) | - | 1510738..1512660 (-) | 1923 | WP_197081171.1 | ABC transporter ATP-binding protein | - |
| ACEY2C_RS07275 (ACEY2C_07275) | - | 1512599..1514338 (-) | 1740 | WP_021149056.1 | ABC transporter ATP-binding protein | - |
| ACEY2C_RS07280 (ACEY2C_07280) | - | 1514640..1516136 (-) | 1497 | WP_003128472.1 | PASTA domain-containing protein | - |
| ACEY2C_RS07285 (ACEY2C_07285) | - | 1516129..1516803 (-) | 675 | WP_003128471.1 | ABC transporter ATP-binding protein | - |
| ACEY2C_RS07290 (ACEY2C_07290) | - | 1516816..1518360 (-) | 1545 | WP_005472842.1 | ABC transporter permease | - |
| ACEY2C_RS07295 (ACEY2C_07295) | dtd | 1518715..1519161 (-) | 447 | WP_003128467.1 | D-aminoacyl-tRNA deacylase | - |
| ACEY2C_RS07300 (ACEY2C_07300) | - | 1519172..1521382 (-) | 2211 | WP_003128466.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| ACEY2C_RS07305 (ACEY2C_07305) | - | 1521591..1522250 (-) | 660 | WP_123866838.1 | deoxyribose-phosphate aldolase | - |
| ACEY2C_RS07310 (ACEY2C_07310) | - | 1522255..1523010 (-) | 756 | WP_005472847.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| ACEY2C_RS07315 (ACEY2C_07315) | prmA | 1523021..1523962 (-) | 942 | WP_123866837.1 | 50S ribosomal protein L11 methyltransferase | - |
| ACEY2C_RS07320 (ACEY2C_07320) | - | 1523974..1524462 (-) | 489 | WP_003128461.1 | DUF3013 family protein | - |
| ACEY2C_RS07325 (ACEY2C_07325) | - | 1524480..1525100 (-) | 621 | WP_005472850.1 | DNA-3-methyladenine glycosylase | - |
| ACEY2C_RS07330 (ACEY2C_07330) | - | 1525277..1526554 (+) | 1278 | WP_005472852.1 | replication-associated recombination protein A | - |
| ACEY2C_RS07340 (ACEY2C_07340) | - | 1526965..1527249 (+) | 285 | WP_005472853.1 | hypothetical protein | - |
| ACEY2C_RS07345 (ACEY2C_07345) | - | 1527313..1527795 (+) | 483 | WP_003128457.1 | universal stress protein | - |
| ACEY2C_RS07350 (ACEY2C_07350) | - | 1528170..1529750 (-) | 1581 | WP_003128454.1 | hypothetical protein | - |
| ACEY2C_RS07355 (ACEY2C_07355) | - | 1529747..1530508 (-) | 762 | WP_005472856.1 | ABC transporter ATP-binding protein | - |
| ACEY2C_RS07360 (ACEY2C_07360) | - | 1530780..1532786 (+) | 2007 | WP_374849445.1 | KUP/HAK/KT family potassium transporter | - |
| ACEY2C_RS07365 (ACEY2C_07365) | - | 1532846..1532974 (+) | 129 | WP_005472862.1 | hypothetical protein | - |
| ACEY2C_RS07370 (ACEY2C_07370) | abc-f | 1533078..1534661 (+) | 1584 | WP_005472864.1 | ribosomal protection-like ABC-F family protein | - |
| ACEY2C_RS07375 (ACEY2C_07375) | - | 1534834..1535691 (-) | 858 | WP_005472866.1 | radical SAM protein | - |
| ACEY2C_RS07380 (ACEY2C_07380) | - | 1535791..1537251 (-) | 1461 | WP_003128449.1 | peptide MFS transporter | - |
| ACEY2C_RS07385 (ACEY2C_07385) | - | 1538242..1538583 (+) | 342 | WP_005472869.1 | PadR family transcriptional regulator | - |
| ACEY2C_RS07390 (ACEY2C_07390) | - | 1538593..1539495 (+) | 903 | WP_374849449.1 | ABC transporter ATP-binding protein | - |
| ACEY2C_RS07395 (ACEY2C_07395) | - | 1539499..1540278 (+) | 780 | WP_005472875.1 | ABC transporter permease | - |
| ACEY2C_RS07400 (ACEY2C_07400) | - | 1540289..1540630 (+) | 342 | WP_003128445.1 | DUF1048 domain-containing protein | - |
| ACEY2C_RS07405 (ACEY2C_07405) | - | 1540640..1540951 (+) | 312 | WP_005472877.1 | DUF1048 domain-containing protein | - |
| ACEY2C_RS07410 (ACEY2C_07410) | - | 1541165..1542349 (-) | 1185 | WP_003128443.1 | acetate/propionate family kinase | - |
| ACEY2C_RS07415 (ACEY2C_07415) | - | 1542374..1543381 (-) | 1008 | WP_029487317.1 | class I SAM-dependent methyltransferase | - |
| ACEY2C_RS07420 (ACEY2C_07420) | - | 1543588..1544999 (+) | 1412 | WP_374849452.1 | IS3 family transposase | - |
| ACEY2C_RS07425 (ACEY2C_07425) | comGG | 1545102..1545407 (-) | 306 | WP_238581784.1 | competence type IV pilus minor pilin ComGG | - |
| ACEY2C_RS07430 (ACEY2C_07430) | comGF | 1545430..1545843 (-) | 414 | WP_003128440.1 | competence type IV pilus minor pilin ComGF | - |
| ACEY2C_RS07435 (ACEY2C_07435) | - | 1545833..1546144 (-) | 312 | WP_029487319.1 | hypothetical protein | - |
| ACEY2C_RS07440 (ACEY2C_07440) | comGD | 1546125..1546604 (-) | 480 | WP_003128438.1 | competence type IV pilus minor pilin ComGD | - |
| ACEY2C_RS07445 (ACEY2C_07445) | comYC | 1546573..1546848 (-) | 276 | WP_029487321.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACEY2C_RS07450 (ACEY2C_07450) | comGB | 1546845..1547876 (-) | 1032 | WP_374849455.1 | competence type IV pilus assembly protein ComGB | - |
| ACEY2C_RS07455 (ACEY2C_07455) | comGA | 1547851..1548792 (-) | 942 | WP_005472888.1 | competence type IV pilus ATPase ComGA | - |
| ACEY2C_RS07460 (ACEY2C_07460) | trmB | 1548904..1549566 (-) | 663 | WP_003128433.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| ACEY2C_RS07465 (ACEY2C_07465) | - | 1549620..1550399 (-) | 780 | WP_003128432.1 | phosphotransferase family protein | - |
| ACEY2C_RS07470 (ACEY2C_07470) | - | 1550504..1551715 (-) | 1212 | WP_029487323.1 | ABC transporter permease | - |
| ACEY2C_RS07475 (ACEY2C_07475) | - | 1551712..1552446 (-) | 735 | WP_003128430.1 | ABC transporter ATP-binding protein | - |
| ACEY2C_RS07480 (ACEY2C_07480) | - | 1552521..1553000 (-) | 480 | WP_003128429.1 | hypothetical protein | - |
| ACEY2C_RS07485 (ACEY2C_07485) | - | 1553197..1553622 (+) | 426 | WP_005472896.1 | HIT family protein | - |
| ACEY2C_RS07490 (ACEY2C_07490) | - | 1553623..1553988 (+) | 366 | WP_021149029.1 | YtxH domain-containing protein | - |
| ACEY2C_RS07495 (ACEY2C_07495) | - | 1554116..1555144 (+) | 1029 | WP_003128425.1 | peptidylprolyl isomerase | - |
| ACEY2C_RS07500 (ACEY2C_07500) | - | 1555183..1556127 (-) | 945 | WP_003128424.1 | 3'-5' exoribonuclease YhaM family protein | - |
| ACEY2C_RS07505 (ACEY2C_07505) | - | 1556156..1558816 (-) | 2661 | WP_005472902.1 | AAA family ATPase | - |
| ACEY2C_RS07510 (ACEY2C_07510) | - | 1558813..1560000 (-) | 1188 | WP_003128421.1 | DNA repair exonuclease | - |
| ACEY2C_RS07515 (ACEY2C_07515) | - | 1560265..1560606 (-) | 342 | WP_003128420.1 | YlbF family regulator | - |
| ACEY2C_RS07520 (ACEY2C_07520) | - | 1560677..1562833 (-) | 2157 | WP_003128419.1 | PBP1A family penicillin-binding protein | - |
| ACEY2C_RS07525 (ACEY2C_07525) | - | 1563027..1563878 (+) | 852 | WP_003128418.1 | RluA family pseudouridine synthase | - |
| ACEY2C_RS07530 (ACEY2C_07530) | - | 1563971..1564696 (-) | 726 | WP_003128417.1 | pseudouridine synthase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.26 Da Isoelectric Point: 6.4633
>NTDB_id=1050433 ACEY2C_RS07445 WP_029487321.1 1546573..1546848(-) (comYC) [Enterococcus gallinarum strain IFEGHNEK1]
MRKLKHQGFTLVEMLIVLLVISILILLFVPNLSAQRTVIDEKGNAAIVKVVETQIELFQLNENRTPTRQELLAGNYVTEE
QYAIYLAHRNE
MRKLKHQGFTLVEMLIVLLVISILILLFVPNLSAQRTVIDEKGNAAIVKVVETQIELFQLNENRTPTRQELLAGNYVTEE
QYAIYLAHRNE
Nucleotide
Download Length: 276 bp
>NTDB_id=1050433 ACEY2C_RS07445 WP_029487321.1 1546573..1546848(-) (comYC) [Enterococcus gallinarum strain IFEGHNEK1]
ATGAGAAAATTGAAGCATCAAGGGTTCACATTGGTGGAGATGCTGATTGTACTGTTAGTGATCAGTATTTTGATTTTATT
GTTTGTACCAAACTTATCCGCACAACGTACAGTGATAGATGAGAAAGGAAATGCGGCAATCGTCAAAGTCGTAGAAACCC
AGATTGAGTTGTTCCAGCTTAATGAGAATCGAACACCTACTCGACAAGAATTACTAGCTGGAAATTATGTAACGGAGGAG
CAGTATGCGATTTACCTTGCCCATCGGAACGAATAG
ATGAGAAAATTGAAGCATCAAGGGTTCACATTGGTGGAGATGCTGATTGTACTGTTAGTGATCAGTATTTTGATTTTATT
GTTTGTACCAAACTTATCCGCACAACGTACAGTGATAGATGAGAAAGGAAATGCGGCAATCGTCAAAGTCGTAGAAACCC
AGATTGAGTTGTTCCAGCTTAATGAGAATCGAACACCTACTCGACAAGAATTACTAGCTGGAAATTATGTAACGGAGGAG
CAGTATGCGATTTACCTTGCCCATCGGAACGAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus suis isolate S10 |
51.613 |
100 |
0.527 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
50.538 |
100 |
0.516 |
| comYC | Streptococcus mutans UA159 |
48.387 |
100 |
0.495 |
| comYC | Streptococcus mutans UA140 |
48.387 |
100 |
0.495 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
48.352 |
100 |
0.484 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
48.352 |
100 |
0.484 |
| comGC/cglC | Streptococcus pneumoniae D39 |
48.352 |
100 |
0.484 |
| comGC/cglC | Streptococcus pneumoniae R6 |
48.352 |
100 |
0.484 |
| comGC/cglC | Streptococcus mitis SK321 |
51.765 |
93.407 |
0.484 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
50 |
96.703 |
0.484 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
48.315 |
97.802 |
0.473 |
| comGC | Staphylococcus aureus MW2 |
44.872 |
85.714 |
0.385 |
| comGC | Staphylococcus aureus N315 |
44.872 |
85.714 |
0.385 |