Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACEPOT_RS12420 | Genome accession | NZ_CP168499 |
| Coordinates | 2545217..2545645 (-) | Length | 142 a.a. |
| NCBI ID | WP_065317076.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain J2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2509352..2553461 | 2545217..2545645 | within | 0 |
Gene organization within MGE regions
Location: 2509352..2553461
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEPOT_RS12160 (ACEPOT_12160) | - | 2509352..2509867 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| ACEPOT_RS12165 (ACEPOT_12165) | - | 2509998..2510159 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| ACEPOT_RS12170 (ACEPOT_12170) | - | 2510486..2510587 (+) | 102 | WP_101305152.1 | hypothetical protein | - |
| ACEPOT_RS12175 (ACEPOT_12175) | - | 2510632..2511633 (-) | 1002 | WP_000593870.1 | restriction endonuclease subunit S | - |
| ACEPOT_RS12180 (ACEPOT_12180) | - | 2511617..2513509 (-) | 1893 | WP_001003361.1 | class I SAM-dependent DNA methyltransferase | - |
| ACEPOT_RS12185 (ACEPOT_12185) | lukF' | 2514022..2514990 (-) | 969 | WP_000669582.1 | bi-component leukocidin LukMF' subunit F' | - |
| ACEPOT_RS12190 (ACEPOT_12190) | lukM | 2514992..2515918 (-) | 927 | WP_065317222.1 | bi-component leukocidin LukMF' subunit M | - |
| ACEPOT_RS12195 (ACEPOT_12195) | - | 2516266..2517021 (-) | 756 | WP_000861033.1 | CHAP domain-containing protein | - |
| ACEPOT_RS12200 (ACEPOT_12200) | - | 2517033..2517287 (-) | 255 | WP_000611513.1 | phage holin | - |
| ACEPOT_RS12205 (ACEPOT_12205) | - | 2517339..2517442 (+) | 104 | Protein_2363 | hypothetical protein | - |
| ACEPOT_RS12210 (ACEPOT_12210) | - | 2517485..2517592 (-) | 108 | WP_000255427.1 | putative holin-like toxin | - |
| ACEPOT_RS12215 (ACEPOT_12215) | - | 2517826..2518122 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| ACEPOT_RS12220 (ACEPOT_12220) | - | 2518180..2518467 (-) | 288 | WP_065317223.1 | hypothetical protein | - |
| ACEPOT_RS12225 (ACEPOT_12225) | - | 2518514..2518666 (-) | 153 | WP_001153680.1 | hypothetical protein | - |
| ACEPOT_RS12230 (ACEPOT_12230) | - | 2518656..2522441 (-) | 3786 | WP_373381095.1 | phage tail spike protein | - |
| ACEPOT_RS12235 (ACEPOT_12235) | - | 2522457..2523947 (-) | 1491 | WP_065317225.1 | phage tail domain-containing protein | - |
| ACEPOT_RS12240 (ACEPOT_12240) | - | 2523947..2528596 (-) | 4650 | WP_373442451.1 | phage tail tape measure protein | - |
| ACEPOT_RS12245 (ACEPOT_12245) | gpGT | 2528652..2528774 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| ACEPOT_RS12250 (ACEPOT_12250) | gpG | 2528834..2529280 (-) | 447 | WP_065317227.1 | phage tail assembly chaperone G | - |
| ACEPOT_RS12255 (ACEPOT_12255) | - | 2529345..2530298 (-) | 954 | WP_065317228.1 | major tail protein | - |
| ACEPOT_RS12260 (ACEPOT_12260) | - | 2530299..2530679 (-) | 381 | WP_000611451.1 | hypothetical protein | - |
| ACEPOT_RS12265 (ACEPOT_12265) | - | 2530676..2531053 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACEPOT_RS12270 (ACEPOT_12270) | - | 2531053..2531388 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| ACEPOT_RS12275 (ACEPOT_12275) | - | 2531375..2531707 (-) | 333 | WP_001177483.1 | head-tail connector protein | - |
| ACEPOT_RS12280 (ACEPOT_12280) | - | 2531716..2531874 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| ACEPOT_RS12285 (ACEPOT_12285) | - | 2531910..2533157 (-) | 1248 | WP_065317229.1 | phage major capsid protein | - |
| ACEPOT_RS12290 (ACEPOT_12290) | - | 2533245..2533829 (-) | 585 | WP_065317230.1 | HK97 family phage prohead protease | - |
| ACEPOT_RS12295 (ACEPOT_12295) | - | 2533795..2535072 (-) | 1278 | WP_065317231.1 | phage portal protein | - |
| ACEPOT_RS12300 (ACEPOT_12300) | - | 2535078..2535278 (-) | 201 | WP_065317238.1 | hypothetical protein | - |
| ACEPOT_RS12305 (ACEPOT_12305) | - | 2535292..2536986 (-) | 1695 | WP_000568450.1 | terminase large subunit | - |
| ACEPOT_RS12310 (ACEPOT_12310) | - | 2536986..2537456 (-) | 471 | WP_000919024.1 | phage terminase small subunit P27 family | - |
| ACEPOT_RS12315 (ACEPOT_12315) | - | 2537585..2537929 (-) | 345 | WP_078369398.1 | HNH endonuclease | - |
| ACEPOT_RS12320 (ACEPOT_12320) | - | 2537945..2538397 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| ACEPOT_RS12325 (ACEPOT_12325) | - | 2538512..2538973 (-) | 462 | WP_053865849.1 | hypothetical protein | - |
| ACEPOT_RS12330 (ACEPOT_12330) | - | 2538996..2539196 (-) | 201 | WP_065317234.1 | DUF1514 family protein | - |
| ACEPOT_RS12335 (ACEPOT_12335) | rinB | 2539196..2539345 (-) | 150 | WP_065317235.1 | transcriptional activator RinB | - |
| ACEPOT_RS12340 (ACEPOT_12340) | - | 2539342..2539548 (-) | 207 | WP_000195824.1 | DUF1381 domain-containing protein | - |
| ACEPOT_RS12345 (ACEPOT_12345) | - | 2539548..2539745 (-) | 198 | WP_000037315.1 | hypothetical protein | - |
| ACEPOT_RS12350 (ACEPOT_12350) | - | 2539742..2539984 (-) | 243 | WP_000028779.1 | hypothetical protein | - |
| ACEPOT_RS12355 (ACEPOT_12355) | - | 2540021..2540533 (-) | 513 | WP_000181820.1 | dUTP diphosphatase | - |
| ACEPOT_RS12360 (ACEPOT_12360) | - | 2540526..2540774 (-) | 249 | WP_065317236.1 | DUF1024 family protein | - |
| ACEPOT_RS12365 (ACEPOT_12365) | - | 2540767..2540994 (-) | 228 | Protein_2395 | hypothetical protein | - |
| ACEPOT_RS12370 (ACEPOT_12370) | - | 2541066..2541314 (-) | 249 | WP_015980409.1 | phi PVL orf 51-like protein | - |
| ACEPOT_RS12375 (ACEPOT_12375) | - | 2541315..2541686 (-) | 372 | Protein_2397 | SA1788 family PVL leukocidin-associated protein | - |
| ACEPOT_RS12380 (ACEPOT_12380) | - | 2541687..2541955 (-) | 269 | Protein_2398 | helix-turn-helix domain-containing protein | - |
| ACEPOT_RS12385 (ACEPOT_12385) | - | 2541956..2542141 (-) | 186 | WP_015980407.1 | DUF3113 family protein | - |
| ACEPOT_RS12390 (ACEPOT_12390) | - | 2542146..2542550 (-) | 405 | WP_015980406.1 | DUF1064 domain-containing protein | - |
| ACEPOT_RS12395 (ACEPOT_12395) | - | 2542561..2542782 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| ACEPOT_RS12400 (ACEPOT_12400) | - | 2542795..2542956 (-) | 162 | WP_065317237.1 | hypothetical protein | - |
| ACEPOT_RS12405 (ACEPOT_12405) | - | 2542950..2543723 (-) | 774 | WP_000803049.1 | ATP-binding protein | - |
| ACEPOT_RS12410 (ACEPOT_12410) | - | 2543733..2544536 (-) | 804 | WP_000504986.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACEPOT_RS12415 (ACEPOT_12415) | - | 2544508..2545203 (-) | 696 | WP_015980404.1 | putative HNHc nuclease | - |
| ACEPOT_RS12420 (ACEPOT_12420) | ssbA | 2545217..2545645 (-) | 429 | WP_065317076.1 | single-stranded DNA-binding protein | Machinery gene |
| ACEPOT_RS12425 (ACEPOT_12425) | - | 2545645..2546283 (-) | 639 | WP_001043063.1 | ERF family protein | - |
| ACEPOT_RS12430 (ACEPOT_12430) | - | 2546283..2546762 (-) | 480 | WP_000002517.1 | siphovirus Gp157 family protein | - |
| ACEPOT_RS12435 (ACEPOT_12435) | - | 2546777..2547037 (-) | 261 | WP_000291093.1 | DUF1108 family protein | - |
| ACEPOT_RS12440 (ACEPOT_12440) | - | 2547130..2547291 (-) | 162 | WP_000048119.1 | DUF1270 family protein | - |
| ACEPOT_RS12445 (ACEPOT_12445) | - | 2547284..2547505 (-) | 222 | WP_000594788.1 | hypothetical protein | - |
| ACEPOT_RS12450 (ACEPOT_12450) | - | 2547576..2547788 (+) | 213 | WP_000461464.1 | hypothetical protein | - |
| ACEPOT_RS12455 (ACEPOT_12455) | - | 2547803..2547880 (-) | 78 | Protein_2413 | hypothetical protein | - |
| ACEPOT_RS12460 (ACEPOT_12460) | - | 2547896..2548648 (-) | 753 | WP_065317075.1 | phage antirepressor KilAC domain-containing protein | - |
| ACEPOT_RS12465 (ACEPOT_12465) | - | 2548704..2549069 (+) | 366 | WP_001128434.1 | hypothetical protein | - |
| ACEPOT_RS12470 (ACEPOT_12470) | - | 2549050..2549283 (-) | 234 | WP_065317074.1 | DUF2829 domain-containing protein | - |
| ACEPOT_RS12475 (ACEPOT_12475) | - | 2549298..2549744 (-) | 447 | WP_061393900.1 | hypothetical protein | - |
| ACEPOT_RS12480 (ACEPOT_12480) | - | 2549765..2549995 (-) | 231 | WP_238839860.1 | helix-turn-helix transcriptional regulator | - |
| ACEPOT_RS12485 (ACEPOT_12485) | - | 2550167..2550877 (+) | 711 | WP_000094091.1 | XRE family transcriptional regulator | - |
| ACEPOT_RS12490 (ACEPOT_12490) | - | 2550889..2551035 (+) | 147 | WP_001049401.1 | hypothetical protein | - |
| ACEPOT_RS12495 (ACEPOT_12495) | - | 2551032..2551217 (+) | 186 | WP_000100503.1 | hypothetical protein | - |
| ACEPOT_RS12500 (ACEPOT_12500) | - | 2551253..2552236 (+) | 984 | WP_000439124.1 | DUF3644 domain-containing protein | - |
| ACEPOT_RS12505 (ACEPOT_12505) | - | 2552415..2553461 (+) | 1047 | WP_065317073.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16126.67 Da Isoelectric Point: 5.8724
>NTDB_id=1044399 ACEPOT_RS12420 WP_065317076.1 2545217..2545645(-) (ssbA) [Staphylococcus aureus strain J2]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLFKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLFKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1044399 ACEPOT_RS12420 WP_065317076.1 2545217..2545645(-) (ssbA) [Staphylococcus aureus strain J2]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATTCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATTCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.613 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |