Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACEPOT_RS10295 | Genome accession | NZ_CP168499 |
| Coordinates | 2152020..2152331 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain J2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2147020..2157331
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEPOT_RS10260 (ACEPOT_10260) | gcvPA | 2147522..2148868 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| ACEPOT_RS10265 (ACEPOT_10265) | gcvT | 2148888..2149979 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACEPOT_RS10270 (ACEPOT_10270) | - | 2150138..2150662 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| ACEPOT_RS10275 (ACEPOT_10275) | - | 2150652..2150798 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| ACEPOT_RS10280 (ACEPOT_10280) | comGF | 2150895..2151392 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACEPOT_RS10285 (ACEPOT_10285) | comGE | 2151310..2151609 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| ACEPOT_RS10290 (ACEPOT_10290) | comGD | 2151596..2152042 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACEPOT_RS10295 (ACEPOT_10295) | comGC | 2152020..2152331 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACEPOT_RS10300 (ACEPOT_10300) | comGB | 2152345..2153415 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACEPOT_RS10305 (ACEPOT_10305) | comGA | 2153387..2154361 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACEPOT_RS10310 (ACEPOT_10310) | - | 2154413..2155036 (-) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| ACEPOT_RS10315 (ACEPOT_10315) | - | 2155033..2155362 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| ACEPOT_RS10320 (ACEPOT_10320) | - | 2155362..2156348 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| ACEPOT_RS10325 (ACEPOT_10325) | - | 2156345..2156548 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=1044386 ACEPOT_RS10295 WP_000472256.1 2152020..2152331(-) (comGC) [Staphylococcus aureus strain J2]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1044386 ACEPOT_RS10295 WP_000472256.1 2152020..2152331(-) (comGC) [Staphylococcus aureus strain J2]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |