Detailed information NTG1041243

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACDZ08_RS07365
• Genome accession: NZ_CP168014
• Coordinates: 1534632..1534943 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain sa230627_barcode16
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1529632..1539943

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACDZ08_RS07330 (ACDZ08_07330)	gcvPA	1530134..1531480 (-)	1347	WP_000019691.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
ACDZ08_RS07335 (ACDZ08_07335)	gcvT	1531500..1532591 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
ACDZ08_RS07340 (ACDZ08_07340)	-	1532750..1533274 (-)	525	WP_001015121.1	shikimate kinase	-
ACDZ08_RS07345 (ACDZ08_07345)	-	1533264..1533410 (-)	147	WP_001789879.1	hypothetical protein	-
ACDZ08_RS07350 (ACDZ08_07350)	comGF	1533507..1534004 (-)	498	WP_029694050.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACDZ08_RS07355 (ACDZ08_07355)	comGE	1533922..1534221 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
ACDZ08_RS07360 (ACDZ08_07360)	comGD	1534208..1534654 (-)	447	WP_072433556.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACDZ08_RS07365 (ACDZ08_07365)	comGC	1534632..1534943 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
ACDZ08_RS07370 (ACDZ08_07370)	comGB	1534957..1536027 (-)	1071	WP_000776421.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACDZ08_RS07375 (ACDZ08_07375)	comGA	1535999..1536973 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
ACDZ08_RS07380 (ACDZ08_07380)	-	1537025..1537648 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
ACDZ08_RS07385 (ACDZ08_07385)	-	1537645..1537974 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
ACDZ08_RS07390 (ACDZ08_07390)	-	1537974..1538960 (-)	987	WP_000161314.1	ROK family glucokinase	-
ACDZ08_RS07395 (ACDZ08_07395)	-	1538957..1539160 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=1041243 ACDZ08_RS07365 WP_000472256.1 1534632..1534943(-) (comGC) [Staphylococcus aureus strain sa230627_barcode16]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1041243 ACDZ08_RS07365 WP_000472256.1 1534632..1534943(-) (comGC) [Staphylococcus aureus strain sa230627_barcode16]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369