Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AB3424_RS02920 | Genome accession | NZ_CP162436 |
| Coordinates | 587786..588211 (+) | Length | 141 a.a. |
| NCBI ID | WP_015978401.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22699 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 574302..624060 | 587786..588211 | within | 0 |
Gene organization within MGE regions
Location: 574302..624060
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB3424_RS02800 (AB3424_02800) | - | 574302..575228 (-) | 927 | WP_000757569.1 | glycerophosphodiester phosphodiesterase | - |
| AB3424_RS02805 (AB3424_02805) | - | 575467..575721 (+) | 255 | WP_001049150.1 | YlbG family protein | - |
| AB3424_RS02810 (AB3424_02810) | - | 575724..576113 (-) | 390 | WP_000814565.1 | hypothetical protein | - |
| AB3424_RS02815 (AB3424_02815) | rsmD | 576182..576724 (+) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| AB3424_RS02820 (AB3424_02820) | coaD | 576726..577208 (+) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| AB3424_RS02825 (AB3424_02825) | - | 577270..578409 (-) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| AB3424_RS02830 (AB3424_02830) | - | 578536..579093 (+) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| AB3424_RS02835 (AB3424_02835) | rpmF | 579173..579346 (+) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| AB3424_RS02840 (AB3424_02840) | - | 579463..580848 (-) | 1386 | WP_117219591.1 | recombinase family protein | - |
| AB3424_RS02845 (AB3424_02845) | - | 581054..581734 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AB3424_RS02850 (AB3424_02850) | - | 581766..582491 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| AB3424_RS02855 (AB3424_02855) | - | 582509..582967 (-) | 459 | WP_000521394.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AB3424_RS02860 (AB3424_02860) | - | 582989..583315 (-) | 327 | WP_000455972.1 | helix-turn-helix domain-containing protein | - |
| AB3424_RS02865 (AB3424_02865) | - | 583478..583687 (+) | 210 | WP_001113664.1 | helix-turn-helix transcriptional regulator | - |
| AB3424_RS02870 (AB3424_02870) | - | 583727..584608 (+) | 882 | WP_000904049.1 | ParB N-terminal domain-containing protein | - |
| AB3424_RS02875 (AB3424_02875) | - | 584601..585368 (+) | 768 | WP_000282677.1 | DUF6551 family protein | - |
| AB3424_RS02880 (AB3424_02880) | - | 585439..585609 (+) | 171 | WP_000398751.1 | hypothetical protein | - |
| AB3424_RS02885 (AB3424_02885) | - | 585598..585807 (-) | 210 | WP_000033736.1 | hypothetical protein | - |
| AB3424_RS02890 (AB3424_02890) | - | 585863..586039 (+) | 177 | WP_001094935.1 | hypothetical protein | - |
| AB3424_RS02895 (AB3424_02895) | - | 586014..586244 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| AB3424_RS02900 (AB3424_02900) | - | 586424..586585 (+) | 162 | WP_031783957.1 | DUF1270 family protein | - |
| AB3424_RS02905 (AB3424_02905) | - | 586679..586939 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| AB3424_RS02910 (AB3424_02910) | - | 586949..587170 (+) | 222 | WP_000815402.1 | DUF2483 family protein | - |
| AB3424_RS02915 (AB3424_02915) | - | 587163..587786 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| AB3424_RS02920 (AB3424_02920) | ssbA | 587786..588211 (+) | 426 | WP_015978401.1 | single-stranded DNA-binding protein | Machinery gene |
| AB3424_RS02925 (AB3424_02925) | - | 588222..588773 (+) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| AB3424_RS02930 (AB3424_02930) | - | 588774..589448 (+) | 675 | WP_029753391.1 | putative HNHc nuclease | - |
| AB3424_RS02935 (AB3424_02935) | - | 589554..590411 (-) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| AB3424_RS02940 (AB3424_02940) | - | 590476..591246 (+) | 771 | WP_000190224.1 | conserved phage C-terminal domain-containing protein | - |
| AB3424_RS02945 (AB3424_02945) | - | 591256..592035 (+) | 780 | WP_000803065.1 | ATP-binding protein | - |
| AB3424_RS02950 (AB3424_02950) | - | 592029..592190 (+) | 162 | WP_000237153.1 | hypothetical protein | - |
| AB3424_RS02955 (AB3424_02955) | - | 592203..592424 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| AB3424_RS02960 (AB3424_02960) | - | 592435..592839 (+) | 405 | WP_000049798.1 | DUF1064 domain-containing protein | - |
| AB3424_RS02965 (AB3424_02965) | - | 592844..593029 (+) | 186 | WP_029051970.1 | DUF3113 family protein | - |
| AB3424_RS02970 (AB3424_02970) | - | 593030..593335 (+) | 306 | WP_029051971.1 | hypothetical protein | - |
| AB3424_RS02975 (AB3424_02975) | - | 593463..593819 (+) | 357 | WP_065315834.1 | SA1788 family PVL leukocidin-associated protein | - |
| AB3424_RS02980 (AB3424_02980) | - | 593823..594065 (+) | 243 | WP_000131395.1 | SAV1978 family virulence-associated passenger protein | - |
| AB3424_RS02985 (AB3424_02985) | - | 594078..594482 (+) | 405 | WP_117219590.1 | hypothetical protein | - |
| AB3424_RS02990 (AB3424_02990) | - | 594479..594844 (+) | 366 | WP_001105615.1 | hypothetical protein | - |
| AB3424_RS02995 (AB3424_02995) | - | 594837..595066 (+) | 230 | Protein_588 | DUF1024 family protein | - |
| AB3424_RS03000 (AB3424_03000) | - | 595059..595589 (+) | 531 | WP_000185662.1 | dUTPase | - |
| AB3424_RS03005 (AB3424_03005) | - | 595626..595832 (+) | 207 | WP_031863839.1 | DUF1381 domain-containing protein | - |
| AB3424_RS03010 (AB3424_03010) | - | 595829..596212 (+) | 384 | WP_117219589.1 | hypothetical protein | - |
| AB3424_RS03015 (AB3424_03015) | - | 596212..596385 (+) | 174 | WP_103146799.1 | transcriptional activator RinB | - |
| AB3424_RS03020 (AB3424_03020) | - | 596386..596532 (+) | 147 | WP_009560343.1 | hypothetical protein | - |
| AB3424_RS03025 (AB3424_03025) | - | 596556..596978 (+) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| AB3424_RS03030 (AB3424_03030) | - | 597165..597605 (+) | 441 | WP_001003272.1 | terminase small subunit | - |
| AB3424_RS03035 (AB3424_03035) | - | 597592..598869 (+) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| AB3424_RS03040 (AB3424_03040) | - | 598880..600415 (+) | 1536 | WP_117219588.1 | phage portal protein | - |
| AB3424_RS03045 (AB3424_03045) | - | 600422..601417 (+) | 996 | WP_368410328.1 | minor capsid protein | - |
| AB3424_RS03050 (AB3424_03050) | - | 601490..601660 (+) | 171 | WP_000072202.1 | hypothetical protein | - |
| AB3424_RS03055 (AB3424_03055) | - | 601688..601781 (+) | 94 | Protein_600 | hypothetical protein | - |
| AB3424_RS03060 (AB3424_03060) | - | 601769..602389 (+) | 621 | WP_000392143.1 | DUF4355 domain-containing protein | - |
| AB3424_RS03065 (AB3424_03065) | - | 602403..603377 (+) | 975 | WP_000438513.1 | phage major capsid protein | - |
| AB3424_RS03070 (AB3424_03070) | - | 603399..603686 (+) | 288 | WP_001114085.1 | hypothetical protein | - |
| AB3424_RS03075 (AB3424_03075) | - | 603695..604027 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| AB3424_RS03080 (AB3424_03080) | - | 604024..604326 (+) | 303 | WP_001268313.1 | hypothetical protein | - |
| AB3424_RS03085 (AB3424_03085) | - | 604326..604673 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AB3424_RS03090 (AB3424_03090) | - | 604685..605068 (+) | 384 | WP_000188649.1 | hypothetical protein | - |
| AB3424_RS03095 (AB3424_03095) | - | 605087..605668 (+) | 582 | WP_000002578.1 | phage major tail protein, TP901-1 family | - |
| AB3424_RS03100 (AB3424_03100) | - | 605731..606096 (+) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| AB3424_RS03105 (AB3424_03105) | - | 606126..606470 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| AB3424_RS03110 (AB3424_03110) | - | 606487..609951 (+) | 3465 | WP_117219587.1 | hypothetical protein | - |
| AB3424_RS03115 (AB3424_03115) | - | 609964..610911 (+) | 948 | WP_000350670.1 | phage tail family protein | - |
| AB3424_RS03120 (AB3424_03120) | - | 610920..612821 (+) | 1902 | WP_000156406.1 | SGNH/GDSL hydrolase family protein | - |
| AB3424_RS03125 (AB3424_03125) | - | 612836..614746 (+) | 1911 | WP_117219586.1 | hypothetical protein | - |
| AB3424_RS03130 (AB3424_03130) | - | 614746..616569 (+) | 1824 | WP_117219585.1 | phage baseplate upper protein | - |
| AB3424_RS03135 (AB3424_03135) | - | 616569..616946 (+) | 378 | WP_096660005.1 | DUF2977 domain-containing protein | - |
| AB3424_RS03140 (AB3424_03140) | - | 616950..617123 (+) | 174 | WP_000782201.1 | XkdX family protein | - |
| AB3424_RS03145 (AB3424_03145) | - | 617163..617462 (+) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| AB3424_RS03150 (AB3424_03150) | - | 617599..619497 (+) | 1899 | WP_116485879.1 | glucosaminidase domain-containing protein | - |
| AB3424_RS03155 (AB3424_03155) | - | 619510..620748 (+) | 1239 | WP_117219584.1 | BppU family phage baseplate upper protein | - |
| AB3424_RS03160 (AB3424_03160) | - | 620754..621149 (+) | 396 | WP_000398856.1 | hypothetical protein | - |
| AB3424_RS03165 (AB3424_03165) | - | 621205..621480 (+) | 276 | WP_000351119.1 | phage holin | - |
| AB3424_RS03170 (AB3424_03170) | - | 621467..622879 (+) | 1413 | WP_154290827.1 | N-acetylmuramoyl-L-alanine amidase | - |
| AB3424_RS03175 (AB3424_03175) | - | 623503..624060 (+) | 558 | WP_000528632.1 | PBECR4 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15947.45 Da Isoelectric Point: 5.8790
>NTDB_id=1025459 AB3424_RS02920 WP_015978401.1 587786..588211(+) (ssbA) [Staphylococcus aureus strain TUM22699]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1025459 AB3424_RS02920 WP_015978401.1 587786..588211(+) (ssbA) [Staphylococcus aureus strain TUM22699]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAATAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAATAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
74.576 |
83.688 |
0.624 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.688 |
0.376 |