Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | U2F28_RS04150 | Genome accession | NZ_CP160635 |
| Coordinates | 858453..858881 (+) | Length | 142 a.a. |
| NCBI ID | WP_064305810.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN44 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 849096..899186 | 858453..858881 | within | 0 |
Gene organization within MGE regions
Location: 849096..899186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2F28_RS04065 (U2F28_004065) | sufB | 849096..850493 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| U2F28_RS04070 (U2F28_004070) | - | 850561..851610 (-) | 1050 | WP_001145726.1 | tyrosine-type recombinase/integrase | - |
| U2F28_RS04075 (U2F28_004075) | - | 851723..851902 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| U2F28_RS04080 (U2F28_004080) | - | 851882..852814 (-) | 933 | WP_000392186.1 | hypothetical protein | - |
| U2F28_RS04085 (U2F28_004085) | - | 852846..853571 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| U2F28_RS04090 (U2F28_004090) | - | 853599..854273 (-) | 675 | WP_322411404.1 | ImmA/IrrE family metallo-endopeptidase | - |
| U2F28_RS04095 (U2F28_004095) | - | 854290..854622 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| U2F28_RS04100 (U2F28_004100) | - | 854885..855079 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| U2F28_RS04105 (U2F28_004105) | - | 855079..855843 (+) | 765 | WP_064305808.1 | phage antirepressor KilAC domain-containing protein | - |
| U2F28_RS04110 (U2F28_004110) | - | 855860..856054 (+) | 195 | WP_001148857.1 | hypothetical protein | - |
| U2F28_RS04115 (U2F28_004115) | - | 856085..856228 (+) | 144 | WP_000939503.1 | hypothetical protein | - |
| U2F28_RS04120 (U2F28_004120) | - | 856249..856806 (-) | 558 | WP_000388992.1 | hypothetical protein | - |
| U2F28_RS04125 (U2F28_004125) | - | 856877..857098 (+) | 222 | WP_064305809.1 | hypothetical protein | - |
| U2F28_RS04130 (U2F28_004130) | - | 857091..857252 (+) | 162 | WP_052995610.1 | DUF1270 family protein | - |
| U2F28_RS04135 (U2F28_004135) | - | 857346..857606 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| U2F28_RS04140 (U2F28_004140) | - | 857616..857837 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| U2F28_RS04145 (U2F28_004145) | - | 857830..858453 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| U2F28_RS04150 (U2F28_004150) | ssbA | 858453..858881 (+) | 429 | WP_064305810.1 | single-stranded DNA-binding protein | Machinery gene |
| U2F28_RS04155 (U2F28_004155) | - | 858895..859563 (+) | 669 | WP_064305811.1 | putative HNHc nuclease | - |
| U2F28_RS04160 (U2F28_004160) | - | 859563..860345 (+) | 783 | WP_017804645.1 | AP2 domain-containing protein | - |
| U2F28_RS04165 (U2F28_004165) | - | 860317..861120 (+) | 804 | WP_000504985.1 | phage replisome organizer N-terminal domain-containing protein | - |
| U2F28_RS04170 (U2F28_004170) | - | 861130..861909 (+) | 780 | WP_000803070.1 | ATP-binding protein | - |
| U2F28_RS04175 (U2F28_004175) | - | 861903..862061 (+) | 159 | WP_000256597.1 | hypothetical protein | - |
| U2F28_RS04180 (U2F28_004180) | - | 862075..862296 (+) | 222 | WP_064305812.1 | DUF3269 family protein | - |
| U2F28_RS04185 (U2F28_004185) | - | 862306..862713 (+) | 408 | WP_064305813.1 | RusA family crossover junction endodeoxyribonuclease | - |
| U2F28_RS04190 (U2F28_004190) | - | 862713..862898 (+) | 186 | WP_031927496.1 | DUF3113 family protein | - |
| U2F28_RS04195 (U2F28_004195) | - | 862899..863516 (+) | 618 | WP_064305814.1 | SA1788 family PVL leukocidin-associated protein | - |
| U2F28_RS04200 (U2F28_004200) | - | 863517..863765 (+) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| U2F28_RS04205 (U2F28_004205) | - | 863780..864031 (+) | 252 | WP_001065046.1 | DUF1024 family protein | - |
| U2F28_RS04210 (U2F28_004210) | - | 864021..864194 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| U2F28_RS04215 (U2F28_004215) | - | 864195..864356 (+) | 162 | WP_000889680.1 | hypothetical protein | - |
| U2F28_RS04220 (U2F28_004220) | - | 864371..864904 (+) | 534 | WP_061839007.1 | dUTPase | - |
| U2F28_RS04225 (U2F28_004225) | - | 864941..865114 (+) | 174 | WP_001209217.1 | hypothetical protein | - |
| U2F28_RS04230 (U2F28_004230) | - | 865131..865337 (+) | 207 | WP_015988673.1 | DUF1381 domain-containing protein | - |
| U2F28_RS04235 (U2F28_004235) | - | 865334..865537 (+) | 204 | WP_015988674.1 | hypothetical protein | - |
| U2F28_RS04240 (U2F28_004240) | - | 865530..865766 (+) | 237 | WP_000608283.1 | hypothetical protein | - |
| U2F28_RS04245 (U2F28_004245) | - | 865756..866145 (+) | 390 | WP_001596346.1 | hypothetical protein | - |
| U2F28_RS04250 (U2F28_004250) | - | 866142..866315 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| U2F28_RS04255 (U2F28_004255) | - | 866316..866462 (+) | 147 | WP_000989998.1 | hypothetical protein | - |
| U2F28_RS04260 (U2F28_004260) | - | 866486..866908 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| U2F28_RS04265 (U2F28_004265) | - | 867239..867733 (+) | 495 | WP_000594087.1 | terminase small subunit | - |
| U2F28_RS04270 (U2F28_004270) | - | 867726..868949 (+) | 1224 | WP_064305815.1 | PBSX family phage terminase large subunit | - |
| U2F28_RS04275 (U2F28_004275) | - | 868946..870370 (+) | 1425 | WP_000177422.1 | phage portal protein | - |
| U2F28_RS04280 (U2F28_004280) | - | 870339..871292 (+) | 954 | WP_000184133.1 | phage head morphogenesis protein | - |
| U2F28_RS04285 (U2F28_004285) | - | 871294..871500 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| U2F28_RS04290 (U2F28_004290) | - | 871603..872187 (+) | 585 | WP_001019219.1 | DUF4355 domain-containing protein | - |
| U2F28_RS04295 (U2F28_004295) | - | 872204..873118 (+) | 915 | WP_000235168.1 | phage major capsid protein | - |
| U2F28_RS04300 (U2F28_004300) | - | 873130..873273 (+) | 144 | WP_000002931.1 | hypothetical protein | - |
| U2F28_RS04305 (U2F28_004305) | - | 873279..873629 (+) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| U2F28_RS04310 (U2F28_004310) | - | 873641..873976 (+) | 336 | WP_000483041.1 | phage head closure protein | - |
| U2F28_RS04315 (U2F28_004315) | - | 873963..874376 (+) | 414 | WP_001151330.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| U2F28_RS04320 (U2F28_004320) | - | 874389..874814 (+) | 426 | WP_000270192.1 | DUF3168 domain-containing protein | - |
| U2F28_RS04325 (U2F28_004325) | - | 874815..875372 (+) | 558 | WP_000057582.1 | tail protein | - |
| U2F28_RS04330 (U2F28_004330) | - | 875439..875945 (+) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| U2F28_RS04335 (U2F28_004335) | - | 875990..876274 (+) | 285 | WP_000880587.1 | hypothetical protein | - |
| U2F28_RS04340 (U2F28_004340) | - | 876278..879163 (+) | 2886 | WP_017431803.1 | hypothetical protein | - |
| U2F28_RS04345 (U2F28_004345) | - | 879178..880119 (+) | 942 | WP_064305816.1 | phage tail domain-containing protein | - |
| U2F28_RS04350 (U2F28_004350) | - | 880130..882016 (+) | 1887 | WP_001122001.1 | SGNH/GDSL hydrolase family protein | - |
| U2F28_RS04355 (U2F28_004355) | - | 882029..883927 (+) | 1899 | WP_322411405.1 | hypothetical protein | - |
| U2F28_RS04360 (U2F28_004360) | - | 883927..885750 (+) | 1824 | WP_064305817.1 | BppU family phage baseplate upper protein | - |
| U2F28_RS04365 (U2F28_004365) | - | 885750..886127 (+) | 378 | WP_061644684.1 | DUF2977 domain-containing protein | - |
| U2F28_RS04370 (U2F28_004370) | - | 886131..886304 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| U2F28_RS04375 (U2F28_004375) | - | 886345..886644 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| U2F28_RS04380 (U2F28_004380) | - | 886781..888655 (+) | 1875 | WP_064305818.1 | glucosaminidase domain-containing protein | - |
| U2F28_RS04385 (U2F28_004385) | - | 888668..889840 (+) | 1173 | WP_053507572.1 | BppU family phage baseplate upper protein | - |
| U2F28_RS04390 (U2F28_004390) | - | 889846..890241 (+) | 396 | WP_015978410.1 | hypothetical protein | - |
| U2F28_RS04395 (U2F28_004395) | - | 890297..890572 (+) | 276 | WP_000351119.1 | phage holin | - |
| U2F28_RS04400 (U2F28_004400) | - | 890559..891971 (+) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| U2F28_RS04405 (U2F28_004405) | - | 892031..892588 (-) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| U2F28_RS04410 (U2F28_004410) | - | 892963..893115 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| U2F28_RS04415 (U2F28_004415) | - | 893186..893296 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| U2F28_RS04420 (U2F28_004420) | - | 893298..893483 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| U2F28_RS04425 (U2F28_004425) | - | 894168..894307 (+) | 140 | Protein_863 | hypothetical protein | - |
| U2F28_RS04430 (U2F28_004430) | - | 894313..894627 (-) | 315 | WP_000274029.1 | hypothetical protein | - |
| U2F28_RS04435 (U2F28_004435) | - | 894992..896032 (+) | 1041 | WP_000582326.1 | hemolysin family protein | - |
| U2F28_RS04440 (U2F28_004440) | - | 896046..897113 (+) | 1068 | WP_000267236.1 | nitronate monooxygenase family protein | - |
| U2F28_RS04445 (U2F28_004445) | - | 897367..897450 (+) | 84 | WP_016170465.1 | hypothetical protein | - |
| U2F28_RS04450 (U2F28_004450) | - | 897498..898346 (+) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| U2F28_RS04455 (U2F28_004455) | - | 898359..899186 (+) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15874.55 Da Isoelectric Point: 8.4724
>NTDB_id=1021792 U2F28_RS04150 WP_064305810.1 858453..858881(+) (ssbA) [Staphylococcus aureus strain BSN44]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKDGKRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKDGKRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1021792 U2F28_RS04150 WP_064305810.1 858453..858881(+) (ssbA) [Staphylococcus aureus strain BSN44]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGATAACAAAGACGGGAAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGATAACAAAGACGGGAAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.69 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.412 |
100 |
0.592 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
74.648 |
0.43 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.259 |
100 |
0.415 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.028 |
100 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.028 |
100 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.028 |
100 |
0.38 |
| ssbB/cilA | Streptococcus mitis SK321 |
38.028 |
100 |
0.38 |